BLASTX nr result
ID: Cnidium21_contig00041779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00041779 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515720.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002515720.1| conserved hypothetical protein [Ricinus communis] gi|223545157|gb|EEF46667.1| conserved hypothetical protein [Ricinus communis] Length = 156 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/63 (44%), Positives = 40/63 (63%) Frame = -3 Query: 198 KPKRDVVKITVDAAVFAETSKYGIGMLARDDEGEVIYGRSALYNGAVRLEYAEAISVKEA 19 KP R VK +DAA F GIG+++ D+EG + G+S NG + ++ AEA+ +KEA Sbjct: 38 KPARGWVKCDMDAATFENGRVIGIGLMSMDEEGRFVKGKSFCMNGRIAIKEAEAMGLKEA 97 Query: 18 LSW 10 LSW Sbjct: 98 LSW 100