BLASTX nr result
ID: Cnidium21_contig00041536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00041536 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324217.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_002535138.1| conserved hypothetical protein [Ricinus comm... 39 1e-05 >ref|XP_002324217.1| predicted protein [Populus trichocarpa] gi|222865651|gb|EEF02782.1| predicted protein [Populus trichocarpa] Length = 83 Score = 62.0 bits (149), Expect = 5e-08 Identities = 41/72 (56%), Positives = 48/72 (66%) Frame = -2 Query: 226 MTASKIDIYIYTRLRLSRTVFRKK*PT*VEGRALLSFNPTILFIVVGALCTYSLYDKQVN 47 MTASK +I+ + L KK PT +GRAL FN TIL IVV +CTYSLYDKQVN Sbjct: 1 MTASKRNIHGHGYPGLCSG---KKWPTRKKGRALSCFNSTILLIVV--VCTYSLYDKQVN 55 Query: 46 GPGARRTERFIK 11 G A RT++FIK Sbjct: 56 GVSAWRTKQFIK 67 >ref|XP_002535138.1| conserved hypothetical protein [Ricinus communis] gi|223523943|gb|EEF27244.1| conserved hypothetical protein [Ricinus communis] Length = 57 Score = 38.5 bits (88), Expect(2) = 1e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 70 SLYDKQVNGPGARRTERFIK 11 SLYDKQVNG GA RTERFIK Sbjct: 31 SLYDKQVNGAGAWRTERFIK 50 Score = 35.8 bits (81), Expect(2) = 1e-05 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 197 IYTVTVISDCVPEKVAYL 144 IYTV VI DCVPEKVAYL Sbjct: 8 IYTVMVIPDCVPEKVAYL 25