BLASTX nr result
ID: Cnidium21_contig00041247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00041247 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315628.1| predicted protein [Populus trichocarpa] gi|2... 93 2e-17 ref|XP_002514993.1| conserved hypothetical protein [Ricinus comm... 91 8e-17 ref|XP_002312640.1| predicted protein [Populus trichocarpa] gi|2... 91 1e-16 ref|XP_003601815.1| hypothetical protein MTR_3g085680 [Medicago ... 89 3e-16 ref|XP_002266100.1| PREDICTED: uncharacterized protein LOC100244... 84 9e-15 >ref|XP_002315628.1| predicted protein [Populus trichocarpa] gi|222864668|gb|EEF01799.1| predicted protein [Populus trichocarpa] Length = 1057 Score = 93.2 bits (230), Expect = 2e-17 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 353 PDTPLFTFLDDEIAPLDLAQRGRPRSLPISISGSSNIERSRRSSKGSASPNRLSTSTRSG 174 P+TPLF LDDE P+++A RGRPRS PISIS SS +E+S RSS+GSASPNRLS S RSG Sbjct: 107 PETPLFPSLDDEPPPVNVASRGRPRSQPISISRSSTMEKSHRSSRGSASPNRLSPSPRSG 166 Query: 173 KSTVQKRG 150 ST Q RG Sbjct: 167 NSTFQSRG 174 >ref|XP_002514993.1| conserved hypothetical protein [Ricinus communis] gi|223546044|gb|EEF47547.1| conserved hypothetical protein [Ricinus communis] Length = 1178 Score = 91.3 bits (225), Expect = 8e-17 Identities = 46/68 (67%), Positives = 54/68 (79%) Frame = -3 Query: 353 PDTPLFTFLDDEIAPLDLAQRGRPRSLPISISGSSNIERSRRSSKGSASPNRLSTSTRSG 174 PDTPLF LDDE P+++A RGRPRS PI+IS SS +E+S RSS+GSASPNRLS S RSG Sbjct: 107 PDTPLFPSLDDEPPPVNVASRGRPRSQPITISRSSTMEKSYRSSRGSASPNRLSPSPRSG 166 Query: 173 KSTVQKRG 150 S+ Q RG Sbjct: 167 NSSFQSRG 174 >ref|XP_002312640.1| predicted protein [Populus trichocarpa] gi|222852460|gb|EEE90007.1| predicted protein [Populus trichocarpa] Length = 1173 Score = 90.9 bits (224), Expect = 1e-16 Identities = 46/68 (67%), Positives = 53/68 (77%) Frame = -3 Query: 353 PDTPLFTFLDDEIAPLDLAQRGRPRSLPISISGSSNIERSRRSSKGSASPNRLSTSTRSG 174 PDTPLF LDDE P+++A RGRPRS PISI+ SS +E+S RSS+GSASPNRLS S SG Sbjct: 107 PDTPLFPSLDDEPPPVNVASRGRPRSQPISIARSSTMEKSHRSSRGSASPNRLSPSLGSG 166 Query: 173 KSTVQKRG 150 ST Q RG Sbjct: 167 NSTFQSRG 174 >ref|XP_003601815.1| hypothetical protein MTR_3g085680 [Medicago truncatula] gi|355490863|gb|AES72066.1| hypothetical protein MTR_3g085680 [Medicago truncatula] Length = 1197 Score = 89.4 bits (220), Expect = 3e-16 Identities = 44/68 (64%), Positives = 55/68 (80%) Frame = -3 Query: 353 PDTPLFTFLDDEIAPLDLAQRGRPRSLPISISGSSNIERSRRSSKGSASPNRLSTSTRSG 174 PDTPLF LD++ P ++A RGRP+S PI+IS SS +E+SRRSS+GSASPNRLS S RSG Sbjct: 128 PDTPLFPSLDEDPPPTNVASRGRPQSKPITISRSSTMEKSRRSSRGSASPNRLSPSPRSG 187 Query: 173 KSTVQKRG 150 +T+Q RG Sbjct: 188 TNTLQARG 195 >ref|XP_002266100.1| PREDICTED: uncharacterized protein LOC100244315 [Vitis vinifera] gi|297738363|emb|CBI27564.3| unnamed protein product [Vitis vinifera] Length = 1184 Score = 84.3 bits (207), Expect = 9e-15 Identities = 43/68 (63%), Positives = 50/68 (73%) Frame = -3 Query: 353 PDTPLFTFLDDEIAPLDLAQRGRPRSLPISISGSSNIERSRRSSKGSASPNRLSTSTRSG 174 PDTPLF LDDE +A RGRPRS PI+IS SS +E+S RSS+GSASP+RLS S RSG Sbjct: 107 PDTPLFPSLDDETTSTTVAHRGRPRSQPITISRSSTMEKSYRSSRGSASPHRLSPSPRSG 166 Query: 173 KSTVQKRG 150 + Q RG Sbjct: 167 NGSFQSRG 174