BLASTX nr result
ID: Cnidium21_contig00041221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00041221 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW86910.1| putative cytochrome C oxidase subunit II family p... 57 2e-06 >gb|AFW86910.1| putative cytochrome C oxidase subunit II family protein [Zea mays] Length = 70 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -1 Query: 100 MSDNGAEVVNLSAP*Q*HTTLDQTAGPVTFRNG 2 MSDNGA VVNLSAP Q HTTLD AGPVTFRNG Sbjct: 1 MSDNGASVVNLSAPQQWHTTLDLRAGPVTFRNG 33