BLASTX nr result
ID: Cnidium21_contig00041150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00041150 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 99 3e-19 ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 95 5e-18 ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabac... 73 2e-11 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 99.4 bits (246), Expect = 3e-19 Identities = 46/48 (95%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = -2 Query: 252 HF-PSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLRLFGRHG 112 HF PSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVL+LFGRHG Sbjct: 556 HFVPSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLKLFGRHG 603 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 95.1 bits (235), Expect = 5e-18 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 88 ASFLHRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSARFVLISD 231 +SFL+RAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTS+RSARFVLI D Sbjct: 37 SSFLYRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARFVLIPD 84 >ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabacum] gi|56806549|dbj|BAD83450.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 108 Score = 73.2 bits (178), Expect = 2e-11 Identities = 41/67 (61%), Positives = 43/67 (64%), Gaps = 13/67 (19%) Frame = +3 Query: 234 MNKKENGTLLFCDSPA-RHQWKQASP------------RLGEEGISIAKDSIQPQVPLRL 374 MNKKENGT+LF P R W P +LGEE ISIAKDSIQPQVPLRL Sbjct: 1 MNKKENGTILFLTRPRLRVLWTLRPPATSGSKLAPYVGKLGEECISIAKDSIQPQVPLRL 60 Query: 375 PCYDFTP 395 PCYDFTP Sbjct: 61 PCYDFTP 67