BLASTX nr result
ID: Cnidium21_contig00041079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00041079 (900 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591456.1| hypothetical protein MTR_1g087730 [Medicago ... 50 7e-11 ref|XP_002467994.1| hypothetical protein SORBIDRAFT_01g037750 [S... 47 3e-07 >ref|XP_003591456.1| hypothetical protein MTR_1g087730 [Medicago truncatula] gi|355480504|gb|AES61707.1| hypothetical protein MTR_1g087730 [Medicago truncatula] Length = 106 Score = 50.1 bits (118), Expect(2) = 7e-11 Identities = 27/66 (40%), Positives = 38/66 (57%) Frame = +3 Query: 501 SSAGERRLEIMSGKVFTRNQMYSSPDMTTISTRVNRLSQVASSPPLKPWVFNDPGMKRKK 680 S ERR+EI+SG+ + +Q Y + + V R S ++P KPW FND KR+K Sbjct: 12 SFGSERRIEIVSGRSYGFSQSYYV-GRSESTGEVTRASHDGAAPVAKPWSFNDAATKRRK 70 Query: 681 SIAKYK 698 IA+YK Sbjct: 71 RIARYK 76 Score = 43.5 bits (101), Expect(2) = 7e-11 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +2 Query: 698 IYTIEDRFKASFRSGFRWIKNKCSEFIHDY 787 +Y +E + KA+FR+G RWIK+ CS +H Y Sbjct: 77 VYAVEGKVKATFRNGIRWIKHTCSRIVHGY 106 >ref|XP_002467994.1| hypothetical protein SORBIDRAFT_01g037750 [Sorghum bicolor] gi|241921848|gb|EER94992.1| hypothetical protein SORBIDRAFT_01g037750 [Sorghum bicolor] Length = 179 Score = 47.0 bits (110), Expect(2) = 3e-07 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = +2 Query: 701 YTIEDRFKASFRSGFRWIKNKCSEFIHDY 787 Y++E + KASFR GFRWIK KCSE IH + Sbjct: 90 YSVEGKVKASFRRGFRWIKAKCSELIHGW 118 Score = 34.3 bits (77), Expect(2) = 3e-07 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = +3 Query: 510 GERRLEIMSGKVFTRNQMYSSPDMTTISTRVNRLSQVASSPPLKPWVFNDPGMKRKKSIA 689 G+RRL+I+ + S P +STR S+ W F+DP MKR++ +A Sbjct: 36 GDRRLDIV-----VKPPARSPPPPLPVSTRSGGSGGAGSA-----WCFSDPEMKRRRRVA 85 Query: 690 KYK 698 YK Sbjct: 86 SYK 88