BLASTX nr result
ID: Cnidium21_contig00040764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00040764 (665 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322764.1| white-brown-complex ABC transporter family [... 58 1e-06 ref|XP_002524100.1| ATP-binding cassette transporter, putative [... 56 7e-06 >ref|XP_002322764.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222867394|gb|EEF04525.1| white-brown-complex ABC transporter family [Populus trichocarpa] Length = 744 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 575 EDLEAGTRKKKIQTEPTLPLYLKFTEVTYK 664 EDLEAGTRK K QTEPTLP+YLKFT+VTYK Sbjct: 129 EDLEAGTRKPKFQTEPTLPIYLKFTDVTYK 158 >ref|XP_002524100.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223536668|gb|EEF38310.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 749 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 575 EDLEAGTRKKKIQTEPTLPLYLKFTEVTYK 664 EDLEAG RK K QTEPTLP+YLKFT+VTYK Sbjct: 131 EDLEAGMRKPKFQTEPTLPIYLKFTDVTYK 160