BLASTX nr result
ID: Cnidium21_contig00040677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00040677 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265980.2| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 ref|XP_003522381.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_002265980.2| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like, partial [Vitis vinifera] Length = 599 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 347 TFVAVLSACNHAGLVDVGIQYFYTMHKDYGVAGK 448 TFVAVLSACNHAG VD+GI+YF +M +DYGV K Sbjct: 330 TFVAVLSACNHAGFVDLGIEYFNSMVRDYGVEAK 363 >ref|XP_003522381.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Glycine max] Length = 635 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 347 TFVAVLSACNHAGLVDVGIQYFYTMHKDYGVAGK 448 TFVAVL ACNHAGLVD+G+QYF TM +D+G+ K Sbjct: 366 TFVAVLLACNHAGLVDLGVQYFNTMRRDFGIETK 399