BLASTX nr result
ID: Cnidium21_contig00040461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00040461 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD23883.1| putative retroelement pol polyprotein [Arabidopsi... 56 4e-06 >gb|AAD23883.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1156 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = +3 Query: 48 GIISTA*VHTNLQLANLFTKALGAAQFSFLLSKLSVRDLHSP 173 GII+T V TN QLA++FTKALG +QF +L+SKL ++DLH+P Sbjct: 1085 GIITTHHVRTNEQLADIFTKALGRSQFLYLMSKLGIQDLHTP 1126