BLASTX nr result
ID: Cnidium21_contig00040069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00040069 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613479.1| hypothetical protein MTR_5g037140 [Medicago ... 58 7e-07 ref|XP_003517891.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 56 3e-06 ref|XP_004146759.1| PREDICTED: uncharacterized protein LOC101209... 55 5e-06 >ref|XP_003613479.1| hypothetical protein MTR_5g037140 [Medicago truncatula] gi|355514814|gb|AES96437.1| hypothetical protein MTR_5g037140 [Medicago truncatula] Length = 124 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 278 HPKSADLDFMSKRRVPNRSDPIHNRRAGNSGRPP 177 H D ++MSKRRVPN DPIHNRRAGNSGRPP Sbjct: 88 HDAQLDFNYMSKRRVPNGPDPIHNRRAGNSGRPP 121 >ref|XP_003517891.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 25-like [Glycine max] Length = 108 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 263 DLDFMSKRRVPNRSDPIHNRRAGNSGRPP 177 D ++MSKRRVPN DPIHNRRAGNSGRPP Sbjct: 77 DFNYMSKRRVPNGPDPIHNRRAGNSGRPP 105 >ref|XP_004146759.1| PREDICTED: uncharacterized protein LOC101209880 [Cucumis sativus] Length = 104 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -2 Query: 260 LDFMSKRRVPNRSDPIHNRRAGNSGRPP 177 L++MSKRRVPN DPIHNRRAGNSGRPP Sbjct: 74 LNYMSKRRVPNGPDPIHNRRAGNSGRPP 101