BLASTX nr result
ID: Cnidium21_contig00039931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039931 (557 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592692.1| Fibrillarin [Medicago truncatula] gi|3583453... 57 3e-06 ref|XP_003552116.1| PREDICTED: rRNA 2'-O-methyltransferase fibri... 55 1e-05 ref|XP_003523175.1| PREDICTED: rRNA 2'-O-methyltransferase fibri... 55 1e-05 >ref|XP_003592692.1| Fibrillarin [Medicago truncatula] gi|358345300|ref|XP_003636719.1| Fibrillarin [Medicago truncatula] gi|355481740|gb|AES62943.1| Fibrillarin [Medicago truncatula] gi|355502654|gb|AES83857.1| Fibrillarin [Medicago truncatula] gi|388494564|gb|AFK35348.1| unknown [Medicago truncatula] Length = 313 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 3/69 (4%) Frame = -1 Query: 557 AVFYLRAGGHYMISTQVNDIDLTSQGKDPFA---NYHRWMEFNPIEVVMLEPIMREYVMA 387 A +YL+AGGH++IS + N ID T + F+ N + +F P+E V LEP R++ Sbjct: 240 ASYYLKAGGHFVISIKANCIDSTVPAEAVFSAEVNKLKADQFKPMEQVTLEPFERDHACV 299 Query: 386 VGGFRVPEE 360 VGG+RVP++ Sbjct: 300 VGGYRVPKK 308 >ref|XP_003552116.1| PREDICTED: rRNA 2'-O-methyltransferase fibrillarin 2-like [Glycine max] Length = 313 Score = 54.7 bits (130), Expect = 1e-05 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 3/69 (4%) Frame = -1 Query: 557 AVFYLRAGGHYMISTQVNDIDLTSQGKDPF---ANYHRWMEFNPIEVVMLEPIMREYVMA 387 A +YL+AGGH++IS + N ID T + F N + +F P E V LEP R++ Sbjct: 239 ASYYLKAGGHFVISIKANCIDSTVPAEAVFESEVNKLKADQFKPFEQVTLEPFERDHACV 298 Query: 386 VGGFRVPEE 360 VGG+R+P++ Sbjct: 299 VGGYRMPKK 307 >ref|XP_003523175.1| PREDICTED: rRNA 2'-O-methyltransferase fibrillarin 2-like [Glycine max] Length = 306 Score = 54.7 bits (130), Expect = 1e-05 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 3/69 (4%) Frame = -1 Query: 557 AVFYLRAGGHYMISTQVNDIDLTSQGKDPF---ANYHRWMEFNPIEVVMLEPIMREYVMA 387 A +YL+AGGH++IS + N ID T + F N + +F P E V LEP R++ Sbjct: 232 ASYYLKAGGHFVISIKANCIDSTVPAEAVFESEVNKLKADQFKPFEQVTLEPFERDHACV 291 Query: 386 VGGFRVPEE 360 VGG+R+P++ Sbjct: 292 VGGYRMPKK 300