BLASTX nr result
ID: Cnidium21_contig00039912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039912 (556 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588536.1| Rhomboid family protein (ISS) [Medicago trun... 55 6e-06 >ref|XP_003588536.1| Rhomboid family protein (ISS) [Medicago truncatula] gi|355477584|gb|AES58787.1| Rhomboid family protein (ISS) [Medicago truncatula] Length = 302 Score = 55.5 bits (132), Expect = 6e-06 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 2/36 (5%) Frame = +3 Query: 453 DMISQLELGKPE--PRRPVKQVNGIFWILFLNIGIF 554 DMISQLE+ KPE R PVK+VNGIFWI+ LNIGIF Sbjct: 71 DMISQLEVAKPELNKREPVKRVNGIFWIILLNIGIF 106