BLASTX nr result
ID: Cnidium21_contig00039903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039903 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514680.1| UDP-glucuronosyltransferase, putative [Ricin... 93 2e-17 ref|XP_002514679.1| UDP-glucuronosyltransferase, putative [Ricin... 89 5e-16 ref|XP_002514682.1| UDP-glucuronosyltransferase, putative [Ricin... 85 5e-15 emb|CBI15140.3| unnamed protein product [Vitis vinifera] 84 9e-15 ref|XP_002284350.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vit... 84 9e-15 >ref|XP_002514680.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223546284|gb|EEF47786.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 384 Score = 93.2 bits (230), Expect = 2e-17 Identities = 43/72 (59%), Positives = 58/72 (80%) Frame = +3 Query: 141 HVLVVPCPAQGHVMPLIKLAYNLAYHNIKVTFANSKFIEAKILAAMSDEDKEQCPIRLVT 320 HV+VVP PAQGHV PL+KLAY+LA H IKVTF N++ I +I++AM +E EQCPI LV+ Sbjct: 6 HVIVVPFPAQGHVAPLMKLAYSLADHGIKVTFINTESIHMRIMSAMPEEFAEQCPISLVS 65 Query: 321 YSDGMESQPDQR 356 +G+ES+PD++ Sbjct: 66 IPEGLESKPDEQ 77 >ref|XP_002514679.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223546283|gb|EEF47785.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 459 Score = 88.6 bits (218), Expect = 5e-16 Identities = 42/77 (54%), Positives = 57/77 (74%) Frame = +3 Query: 126 MDLHQHVLVVPCPAQGHVMPLIKLAYNLAYHNIKVTFANSKFIEAKILAAMSDEDKEQCP 305 M+ HV+V+P PAQGHV PL+KLAY LA H IKVTF NS+ I +I+AAM + +E+ P Sbjct: 1 MEKKPHVIVIPYPAQGHVAPLMKLAYKLADHGIKVTFVNSESIHGRIMAAMPENLEEKIP 60 Query: 306 IRLVTYSDGMESQPDQR 356 I L++ SDG+ES D++ Sbjct: 61 ISLISISDGVESNRDRK 77 >ref|XP_002514682.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223546286|gb|EEF47788.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 457 Score = 85.1 bits (209), Expect = 5e-15 Identities = 44/87 (50%), Positives = 59/87 (67%) Frame = +3 Query: 126 MDLHQHVLVVPCPAQGHVMPLIKLAYNLAYHNIKVTFANSKFIEAKILAAMSDEDKEQCP 305 M HV+ VP PAQGHV PL+KLAYNLA H I VTF N++ I KI++AM ++ EQCP Sbjct: 1 MGSKSHVIFVPFPAQGHVSPLMKLAYNLADHGIMVTFVNTESIHMKIMSAMPEKFAEQCP 60 Query: 306 IRLVTYSDGMESQPDQRYGQGLMDSLK 386 I LV+ + ++S PD GQ ++L+ Sbjct: 61 ISLVSIPEVLQSTPD---GQDKWETLE 84 >emb|CBI15140.3| unnamed protein product [Vitis vinifera] Length = 633 Score = 84.3 bits (207), Expect = 9e-15 Identities = 42/86 (48%), Positives = 59/86 (68%) Frame = +3 Query: 126 MDLHQHVLVVPCPAQGHVMPLIKLAYNLAYHNIKVTFANSKFIEAKILAAMSDEDKEQCP 305 M HVLVVP PAQGHV PL+KLA+ ++ H IKVTF N++FI AKI+A+M D+D +Q Sbjct: 209 MGRRPHVLVVPFPAQGHVAPLMKLAHKVSDHGIKVTFVNTEFIHAKIMASMPDKDGKQSR 268 Query: 306 IRLVTYSDGMESQPDQRYGQGLMDSL 383 I LV+ DG+ + ++ L +S+ Sbjct: 269 IELVSVPDGLNPEANRNDAVMLTESI 294 >ref|XP_002284350.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Length = 456 Score = 84.3 bits (207), Expect = 9e-15 Identities = 38/72 (52%), Positives = 51/72 (70%) Frame = +3 Query: 141 HVLVVPCPAQGHVMPLIKLAYNLAYHNIKVTFANSKFIEAKILAAMSDEDKEQCPIRLVT 320 HVL++PCPAQGHV PL+K AY ++ H IKVTF NS FI K++AA+ DED+ Q I L + Sbjct: 5 HVLIIPCPAQGHVTPLMKFAYQISDHGIKVTFVNSDFIHEKLVAALPDEDEAQSRIGLAS 64 Query: 321 YSDGMESQPDQR 356 DG+ D++ Sbjct: 65 IPDGLGPGEDRK 76