BLASTX nr result
ID: Cnidium21_contig00039772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039772 (589 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66008.1| hypothetical protein [Beta vulgaris subsp. vulga... 59 8e-07 >emb|CCA66008.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 678 Score = 58.5 bits (140), Expect = 8e-07 Identities = 32/68 (47%), Positives = 40/68 (58%), Gaps = 3/68 (4%) Frame = +2 Query: 392 EDERCPIILLTNEEKIRMRKPWKNFLIIKTFDGNIGYMSLV*IVKIMEHQDSRASLTD-- 565 EDE CP I LT EEK R+R PW+N LIIK FD + Y LV +K + +LTD Sbjct: 115 EDESCPTIYLTKEEKRRIRHPWRNSLIIKLFDRRLSYDILVRRLKYKWNLKGDIALTDVG 174 Query: 566 -KYFIARF 586 Y++ RF Sbjct: 175 HAYYVVRF 182