BLASTX nr result
ID: Cnidium21_contig00039649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039649 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV46191.1| argonaute1-2, partial [Solanum lycopersicum] 55 8e-06 gb|AFV15378.1| AGO1B [Solanum lycopersicum] 55 8e-06 >gb|AFV46191.1| argonaute1-2, partial [Solanum lycopersicum] Length = 1152 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 138 MFSTPFIEPLLLIEFASQMLNRDVSSRPMSDCDCVK 31 M ST FIEPLL+++F +Q+LNRDVSSRP+SD D VK Sbjct: 479 MSSTSFIEPLLVVDFVAQLLNRDVSSRPLSDADRVK 514 >gb|AFV15378.1| AGO1B [Solanum lycopersicum] Length = 1152 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 138 MFSTPFIEPLLLIEFASQMLNRDVSSRPMSDCDCVK 31 M ST FIEPLL+++F +Q+LNRDVSSRP+SD D VK Sbjct: 479 MSSTSFIEPLLVVDFVAQLLNRDVSSRPLSDADRVK 514