BLASTX nr result
ID: Cnidium21_contig00039608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039608 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265467.1| PREDICTED: uncharacterized protein LOC100263... 60 2e-07 ref|XP_002521024.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002314724.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002312513.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 emb|CAN69794.1| hypothetical protein VITISV_022544 [Vitis vinifera] 60 2e-07 >ref|XP_002265467.1| PREDICTED: uncharacterized protein LOC100263777 [Vitis vinifera] gi|296086531|emb|CBI32120.3| unnamed protein product [Vitis vinifera] Length = 491 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 219 AISSRPMMKFESGYSVETVFDGSKLGIEPYT 311 AISSR MMKFESGY+VETVFDGSKLGIEPY+ Sbjct: 57 AISSRSMMKFESGYTVETVFDGSKLGIEPYS 87 >ref|XP_002521024.1| conserved hypothetical protein [Ricinus communis] gi|223539861|gb|EEF41441.1| conserved hypothetical protein [Ricinus communis] Length = 500 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 219 AISSRPMMKFESGYSVETVFDGSKLGIEPYT 311 AIS RPMMKFE GY+VETVFDGSKLGIEPY+ Sbjct: 65 AISGRPMMKFEGGYNVETVFDGSKLGIEPYS 95 >ref|XP_002314724.1| predicted protein [Populus trichocarpa] gi|222863764|gb|EEF00895.1| predicted protein [Populus trichocarpa] Length = 487 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 222 ISSRPMMKFESGYSVETVFDGSKLGIEPYT 311 IS RPMMKFESGY+VETVFDGSKLGIEPY+ Sbjct: 64 ISGRPMMKFESGYTVETVFDGSKLGIEPYS 93 >ref|XP_002312513.1| predicted protein [Populus trichocarpa] gi|222852333|gb|EEE89880.1| predicted protein [Populus trichocarpa] Length = 494 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 222 ISSRPMMKFESGYSVETVFDGSKLGIEPYT 311 IS RPMMKFESGY+VETVFDGSKLGIEPY+ Sbjct: 61 ISGRPMMKFESGYTVETVFDGSKLGIEPYS 90 >emb|CAN69794.1| hypothetical protein VITISV_022544 [Vitis vinifera] Length = 491 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 219 AISSRPMMKFESGYSVETVFDGSKLGIEPYT 311 AISSR MMKFESGY+VETVFDGSKLGIEPY+ Sbjct: 57 AISSRSMMKFESGYTVETVFDGSKLGIEPYS 87