BLASTX nr result
ID: Cnidium21_contig00039605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039605 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314533.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_004141529.1| PREDICTED: probable nucleoredoxin 1-like [Cu... 56 3e-06 ref|NP_564756.1| putative nucleoredoxin 1 [Arabidopsis thaliana]... 56 3e-06 ref|XP_002314535.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002314534.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002314533.1| predicted protein [Populus trichocarpa] gi|222863573|gb|EEF00704.1| predicted protein [Populus trichocarpa] Length = 535 Score = 57.0 bits (136), Expect = 2e-06 Identities = 33/74 (44%), Positives = 43/74 (58%) Frame = -1 Query: 250 EDSFLDEIKTMPWLALPFKDTNCNKKLQRLFQHPQELGEPVPARLVIIGPHGKFIEPLGT 71 E+ F + +TMPWLALPFKD +C KKL R F+ +P LVIIG GK + P Sbjct: 215 EEDFKESFETMPWLALPFKDKSC-KKLARYFEL-----RTIP-NLVIIGQDGKTLNPNVA 267 Query: 70 YIFLRYGAPAYPFS 29 + +G AYPF+ Sbjct: 268 ELIEDHGIEAYPFT 281 >ref|XP_004141529.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus] gi|449481478|ref|XP_004156195.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus] Length = 562 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/82 (37%), Positives = 44/82 (53%) Frame = -1 Query: 250 EDSFLDEIKTMPWLALPFKDTNCNKKLQRLFQHPQELGEPVPARLVIIGPHGKFIEPLGT 71 EDSF D MPWL+ PF D+ K+L+ LF + G P RLV++ P GK G Sbjct: 82 EDSFKDYFSKMPWLSFPFSDSEIVKRLKELF---EVRGIP---RLVVLDPSGKVSTDQGV 135 Query: 70 YIFLRYGAPAYPFSLQSAVNLE 5 + +G AYPF+ + +L+ Sbjct: 136 RLVTEHGISAYPFTAEQIQHLK 157 >ref|NP_564756.1| putative nucleoredoxin 1 [Arabidopsis thaliana] gi|75318691|sp|O80763.1|NRX1_ARATH RecName: Full=Probable nucleoredoxin 1; Short=AtNrx1 gi|3249084|gb|AAC24068.1| Similar to red-1 (related to thioredoxin) gene gb|X92750 from Mus musculus. ESTs gb|AA712687 and gb|Z37223 come from this gene [Arabidopsis thaliana] gi|17529294|gb|AAL38874.1| unknown protein [Arabidopsis thaliana] gi|21436119|gb|AAM51306.1| unknown protein [Arabidopsis thaliana] gi|332195563|gb|AEE33684.1| putative nucleoredoxin 1 [Arabidopsis thaliana] Length = 578 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/74 (40%), Positives = 41/74 (55%) Frame = -1 Query: 250 EDSFLDEIKTMPWLALPFKDTNCNKKLQRLFQHPQELGEPVPARLVIIGPHGKFIEPLGT 71 E+SF D + MPWLA+PF D+ +L LF + G P LV++ HGK + G Sbjct: 89 EESFGDYFRKMPWLAVPFTDSETRDRLDELF---KVRGIP---NLVMVDDHGKLVNENGV 142 Query: 70 YIFLRYGAPAYPFS 29 + YGA AYPF+ Sbjct: 143 GVIRSYGADAYPFT 156 >ref|XP_002314535.1| predicted protein [Populus trichocarpa] gi|222863575|gb|EEF00706.1| predicted protein [Populus trichocarpa] Length = 501 Score = 55.8 bits (133), Expect = 3e-06 Identities = 32/74 (43%), Positives = 43/74 (58%) Frame = -1 Query: 250 EDSFLDEIKTMPWLALPFKDTNCNKKLQRLFQHPQELGEPVPARLVIIGPHGKFIEPLGT 71 E+ F + +TMPWLALPFKD +C +KL R F+ +P LVIIG GK + P Sbjct: 244 EEDFKESFETMPWLALPFKDKSC-EKLVRYFEL-----RTIP-NLVIIGQDGKTLNPNVA 296 Query: 70 YIFLRYGAPAYPFS 29 + +G AYPF+ Sbjct: 297 ELIEEHGIEAYPFT 310 >ref|XP_002314534.1| predicted protein [Populus trichocarpa] gi|222863574|gb|EEF00705.1| predicted protein [Populus trichocarpa] Length = 564 Score = 55.8 bits (133), Expect = 3e-06 Identities = 32/74 (43%), Positives = 43/74 (58%) Frame = -1 Query: 250 EDSFLDEIKTMPWLALPFKDTNCNKKLQRLFQHPQELGEPVPARLVIIGPHGKFIEPLGT 71 E+ F + +TMPWLALPFKD +C +KL R F+ +P LVIIG GK + P Sbjct: 244 EEDFKESFETMPWLALPFKDKSC-EKLVRYFEL-----RTIP-NLVIIGQDGKTLNPNVA 296 Query: 70 YIFLRYGAPAYPFS 29 + +G AYPF+ Sbjct: 297 ELIEEHGIEAYPFT 310