BLASTX nr result
ID: Cnidium21_contig00039577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039577 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] 55 8e-06 >dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] Length = 573 Score = 54.7 bits (130), Expect = 8e-06 Identities = 39/111 (35%), Positives = 52/111 (46%), Gaps = 33/111 (29%) Frame = +1 Query: 211 KAGRYAKASKCNKKVAKYMEYHIWRR*ENAGQ--------------------DIKRDLQV 330 KAG+Y +ASK +K AK++EY E Q D K+ ++ Sbjct: 412 KAGKYTRASKRYEKAAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKQAEKL 471 Query: 331 ATSIMHLAN*N*RIIY-------------FTEFDIKKALEIDPENRDVKLE 444 T ++ L + N + +Y EFDIKKALEIDP NRDVKLE Sbjct: 472 CTKVLELESTNVKALYRRAQAYMNMADLDLAEFDIKKALEIDPNNRDVKLE 522