BLASTX nr result
ID: Cnidium21_contig00039575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039575 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274573.1| PREDICTED: translocase of chloroplast 34, ch... 95 5e-18 emb|CAN63847.1| hypothetical protein VITISV_028305 [Vitis vinifera] 95 5e-18 ref|XP_004170233.1| PREDICTED: translocase of chloroplast 34-lik... 91 7e-17 gb|AFL55360.1| chloroplast preprotein import receptor Toc34 [Bie... 91 1e-16 ref|XP_004146141.1| PREDICTED: translocase of chloroplast 34-lik... 90 2e-16 >ref|XP_002274573.1| PREDICTED: translocase of chloroplast 34, chloroplastic [Vitis vinifera] gi|296083376|emb|CBI23265.3| unnamed protein product [Vitis vinifera] Length = 310 Score = 95.1 bits (235), Expect = 5e-18 Identities = 44/57 (77%), Positives = 52/57 (91%) Frame = +2 Query: 128 IPVVLVENSTRCSRNENDEKIIPSGIAWIPNLMKTITEVVSNGSKGIKVNKKLIDGP 298 IPVVLVENS RC +NE+DEKI+P+G AWIPNL+KTIT+ VSNGSKGI V+KKLI+GP Sbjct: 203 IPVVLVENSGRCHKNESDEKILPNGTAWIPNLVKTITDAVSNGSKGILVDKKLIEGP 259 >emb|CAN63847.1| hypothetical protein VITISV_028305 [Vitis vinifera] Length = 310 Score = 95.1 bits (235), Expect = 5e-18 Identities = 44/57 (77%), Positives = 52/57 (91%) Frame = +2 Query: 128 IPVVLVENSTRCSRNENDEKIIPSGIAWIPNLMKTITEVVSNGSKGIKVNKKLIDGP 298 IPVVLVENS RC +NE+DEKI+P+G AWIPNL+KTIT+ VSNGSKGI V+KKLI+GP Sbjct: 203 IPVVLVENSGRCHKNESDEKILPNGTAWIPNLVKTITDAVSNGSKGILVDKKLIEGP 259 >ref|XP_004170233.1| PREDICTED: translocase of chloroplast 34-like [Cucumis sativus] Length = 312 Score = 91.3 bits (225), Expect = 7e-17 Identities = 42/58 (72%), Positives = 53/58 (91%) Frame = +2 Query: 125 AIPVVLVENSTRCSRNENDEKIIPSGIAWIPNLMKTITEVVSNGSKGIKVNKKLIDGP 298 +IPVVLVENS RCS+NE DEK++P+GIAWIP+L++TIT+VV NGSK I V+KKLI+GP Sbjct: 202 SIPVVLVENSGRCSKNEKDEKVLPNGIAWIPHLVETITKVVLNGSKSIFVDKKLIEGP 259 >gb|AFL55360.1| chloroplast preprotein import receptor Toc34 [Bienertia sinuspersici] Length = 311 Score = 90.9 bits (224), Expect = 1e-16 Identities = 39/58 (67%), Positives = 54/58 (93%) Frame = +2 Query: 125 AIPVVLVENSTRCSRNENDEKIIPSGIAWIPNLMKTITEVVSNGSKGIKVNKKLIDGP 298 ++PVVLVENS RC++NE+ EKI+P+G++WIPN++KTI +V+SNGSKGI V+KKLI+GP Sbjct: 202 SMPVVLVENSGRCNKNESGEKILPNGVSWIPNMVKTIIDVISNGSKGILVDKKLIEGP 259 >ref|XP_004146141.1| PREDICTED: translocase of chloroplast 34-like [Cucumis sativus] Length = 312 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/58 (72%), Positives = 52/58 (89%) Frame = +2 Query: 125 AIPVVLVENSTRCSRNENDEKIIPSGIAWIPNLMKTITEVVSNGSKGIKVNKKLIDGP 298 +IPVVLVENS RCS+NE DEK++P+GIAWIP L++TIT+VV NGSK I V+KKLI+GP Sbjct: 202 SIPVVLVENSGRCSKNEKDEKVLPNGIAWIPYLVETITKVVLNGSKSIFVDKKLIEGP 259