BLASTX nr result
ID: Cnidium21_contig00039471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039471 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291805.1| orf35 gene product (mitochondrion) [Daucus c... 70 2e-10 >ref|YP_006291805.1| orf35 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081981|gb|AEY81173.1| orf35 (mitochondrion) [Daucus carota subsp. sativus] Length = 373 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +2 Query: 140 LILRWPTNEGVVGLLKAVLWYKLNYQRCRNNDLFVG 247 +ILR PTNEGVVGLLKAVLW K NYQRCRNNDLFVG Sbjct: 1 MILRRPTNEGVVGLLKAVLWSKFNYQRCRNNDLFVG 36