BLASTX nr result
ID: Cnidium21_contig00039430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039430 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002882826.1| transcription factor IID-1 [Arabidopsis lyra... 109 3e-22 pdb|1VTO|A Chain A, 1.9 A Resolution Refined Structure Of Tbp Re... 107 8e-22 pdb|1VTL|E Chain E, Co-Crystal Structure Of Tbp Recognizing The ... 107 8e-22 ref|NP_187953.1| TATA-box-binding protein 1 [Arabidopsis thalian... 107 8e-22 ref|XP_002319167.1| global transcription factor group [Populus t... 107 1e-21 >ref|XP_002882826.1| transcription factor IID-1 [Arabidopsis lyrata subsp. lyrata] gi|297328666|gb|EFH59085.1| transcription factor IID-1 [Arabidopsis lyrata subsp. lyrata] Length = 200 Score = 109 bits (272), Expect = 3e-22 Identities = 52/63 (82%), Positives = 58/63 (92%) Frame = +3 Query: 9 NHAAFTSYEPELFPGLIYRMKDPKIVLLLFVSGKIVITGGKKKEEIYKAFANIYPVLTQF 188 +HAAF+SYEPELFPGLIYRMK PKIVLL+FVSGKIVITG K +EE Y+AF NIYPVLT+F Sbjct: 136 SHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMREETYRAFENIYPVLTEF 195 Query: 189 RKI 197 RKI Sbjct: 196 RKI 198 >pdb|1VTO|A Chain A, 1.9 A Resolution Refined Structure Of Tbp Recognizing The Minor Groove Of Tataaaag gi|339961163|pdb|1VTO|B Chain B, 1.9 A Resolution Refined Structure Of Tbp Recognizing The Minor Groove Of Tataaaag Length = 190 Score = 107 bits (268), Expect = 8e-22 Identities = 51/63 (80%), Positives = 58/63 (92%) Frame = +3 Query: 9 NHAAFTSYEPELFPGLIYRMKDPKIVLLLFVSGKIVITGGKKKEEIYKAFANIYPVLTQF 188 +HAAF+SYEPELFPGLIYRMK PKIVLL+FVSGKIVITG K ++E YKAF NIYPVL++F Sbjct: 126 SHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEF 185 Query: 189 RKI 197 RKI Sbjct: 186 RKI 188 >pdb|1VTL|E Chain E, Co-Crystal Structure Of Tbp Recognizing The Minor Groove Of A Tata Element gi|339961158|pdb|1VTL|F Chain F, Co-Crystal Structure Of Tbp Recognizing The Minor Groove Of A Tata Element Length = 186 Score = 107 bits (268), Expect = 8e-22 Identities = 51/63 (80%), Positives = 58/63 (92%) Frame = +3 Query: 9 NHAAFTSYEPELFPGLIYRMKDPKIVLLLFVSGKIVITGGKKKEEIYKAFANIYPVLTQF 188 +HAAF+SYEPELFPGLIYRMK PKIVLL+FVSGKIVITG K ++E YKAF NIYPVL++F Sbjct: 124 SHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEF 183 Query: 189 RKI 197 RKI Sbjct: 184 RKI 186 >ref|NP_187953.1| TATA-box-binding protein 1 [Arabidopsis thaliana] gi|135626|sp|P28147.1|TBP1_ARATH RecName: Full=TATA-box-binding protein 1; AltName: Full=TATA sequence-binding protein 1; Short=TBP-1; AltName: Full=TATA-binding factor 1; AltName: Full=TATA-box factor 1; AltName: Full=Transcription initiation factor TFIID TBP-1 subunit gi|1943466|pdb|1VOK|A Chain A, Arabidopsis Thaliana Tbp (Dimer) gi|1943467|pdb|1VOK|B Chain B, Arabidopsis Thaliana Tbp (Dimer) gi|1943469|pdb|1VOL|B Chain B, Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEMENT Ternary Complex gi|7245860|pdb|1QN5|A Chain A, Crystal Structure Of The G(-26) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245861|pdb|1QN5|B Chain B, Crystal Structure Of The G(-26) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245866|pdb|1QN6|A Chain A, Crystal Structure Of The T(-26) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245867|pdb|1QN6|B Chain B, Crystal Structure Of The T(-26) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245872|pdb|1QN7|A Chain A, Crystal Structure Of The T(-27) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245873|pdb|1QN7|B Chain B, Crystal Structure Of The T(-27) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245878|pdb|1QN8|A Chain A, Crystal Structure Of The T(-28) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245879|pdb|1QN8|B Chain B, Crystal Structure Of The T(-28) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245884|pdb|1QN9|A Chain A, Crystal Structure Of The C(-29) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245885|pdb|1QN9|B Chain B, Crystal Structure Of The C(-29) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245890|pdb|1QNA|A Chain A, Crystal Structure Of The T(-30) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245891|pdb|1QNA|B Chain B, Crystal Structure Of The T(-30) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245896|pdb|1QNB|A Chain A, Crystal Structure Of The T(-25) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245897|pdb|1QNB|B Chain B, Crystal Structure Of The T(-25) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245902|pdb|1QNC|A Chain A, Crystal Structure Of The A(-31) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245903|pdb|1QNC|B Chain B, Crystal Structure Of The A(-31) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245908|pdb|1QNE|A Chain A, Crystal Structure Of The Adenovirus Major Late Promoter Tata Box Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). gi|7245909|pdb|1QNE|B Chain B, Crystal Structure Of The Adenovirus Major Late Promoter Tata Box Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). gi|7245938|pdb|1QN3|A Chain A, Crystal Structure Of The C(-25) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245939|pdb|1QN3|B Chain B, Crystal Structure Of The C(-25) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7246010|pdb|1QN4|A Chain A, Crystal Structure Of The T(-24) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7246011|pdb|1QN4|B Chain B, Crystal Structure Of The T(-24) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|11692888|gb|AAG40047.1|AF324696_1 AT3g13445 [Arabidopsis thaliana] gi|11935207|gb|AAG42019.1|AF327429_1 putative transcription initiation factor TFIID-1 [Arabidopsis thaliana] gi|13194816|gb|AAK15570.1|AF349523_1 putative TATA sequence-binding transcription initiation factor protein [Arabidopsis thaliana] gi|16548|emb|CAA38743.1| transcription initiation factor II [Arabidopsis thaliana] gi|9280296|dbj|BAB01751.1| transcription initiation factor TFIID-1 (TATA-box factor 1) (TATA sequence-binding protein 1) (TBP-1) [Arabidopsis thaliana] gi|15451056|gb|AAK96799.1| transcription initiation factor TFIID-1 (TATA-box factor 1) (TATA sequence-binding protein 1) (TBP-1) [Arabidopsis thaliana] gi|18377408|gb|AAL66870.1| transcription initiation factor TFIID-1 [Arabidopsis thaliana] gi|21537103|gb|AAM61444.1| transcription initiation factor TFIID-1 (TATA sequence-binding protein 1) [Arabidopsis thaliana] gi|39545928|gb|AAR28027.1| TBP1 [Arabidopsis thaliana] gi|225898637|dbj|BAH30449.1| hypothetical protein [Arabidopsis thaliana] gi|332641834|gb|AEE75355.1| TATA-box-binding protein 1 [Arabidopsis thaliana] gi|227074|prf||1613452B transcription initiation factor TFIID-2 Length = 200 Score = 107 bits (268), Expect = 8e-22 Identities = 51/63 (80%), Positives = 58/63 (92%) Frame = +3 Query: 9 NHAAFTSYEPELFPGLIYRMKDPKIVLLLFVSGKIVITGGKKKEEIYKAFANIYPVLTQF 188 +HAAF+SYEPELFPGLIYRMK PKIVLL+FVSGKIVITG K ++E YKAF NIYPVL++F Sbjct: 136 SHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEF 195 Query: 189 RKI 197 RKI Sbjct: 196 RKI 198 >ref|XP_002319167.1| global transcription factor group [Populus trichocarpa] gi|222857543|gb|EEE95090.1| global transcription factor group [Populus trichocarpa] Length = 202 Score = 107 bits (266), Expect = 1e-21 Identities = 50/63 (79%), Positives = 56/63 (88%) Frame = +3 Query: 9 NHAAFTSYEPELFPGLIYRMKDPKIVLLLFVSGKIVITGGKKKEEIYKAFANIYPVLTQF 188 +H AF+SYEPELFPGLIYRMK PKIVLL+FVSGKIVITG K +EE Y AF NIYPVLT+F Sbjct: 137 SHGAFSSYEPELFPGLIYRMKQPKIVLLIFVSGKIVITGAKVREETYTAFENIYPVLTEF 196 Query: 189 RKI 197 RK+ Sbjct: 197 RKV 199