BLASTX nr result
ID: Cnidium21_contig00039272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039272 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531596.1| pentatricopeptide repeat-containing protein,... 63 3e-08 emb|CBI20322.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002282230.1| PREDICTED: pentatricopeptide repeat-containi... 58 7e-07 ref|XP_003545936.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_002517927.1| pentatricopeptide repeat-containing protein,... 57 1e-06 >ref|XP_002531596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528792|gb|EEF30799.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 300 Score = 62.8 bits (151), Expect = 3e-08 Identities = 33/72 (45%), Positives = 46/72 (63%) Frame = -2 Query: 218 TRTGPLLWLRSYSSPTQSKPNENSRLFQRISTLRDPKVSIIPVLDQWITQGNTLKEPQFQ 39 T T W R + K N N +L++RIS + DPKVSI+P+LDQWI +G ++ + Q Q Sbjct: 32 TPTSSQKWFRE-----RGKDNLN-QLYRRISPVGDPKVSIVPILDQWIEEGKSVNKDQLQ 85 Query: 38 RFVRELRARKRY 3 F++ELR KRY Sbjct: 86 VFIKELRYCKRY 97 >emb|CBI20322.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/50 (46%), Positives = 36/50 (72%) Frame = -2 Query: 152 NSRLFQRISTLRDPKVSIIPVLDQWITQGNTLKEPQFQRFVRELRARKRY 3 N L+ RIS L P +S++PVLDQW+ +G +++ + R +R+LR+RKRY Sbjct: 36 NINLYSRISPLGTPNLSLVPVLDQWVEEGKKVRDVELHRIIRDLRSRKRY 85 >ref|XP_002282230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial [Vitis vinifera] Length = 504 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/50 (46%), Positives = 36/50 (72%) Frame = -2 Query: 152 NSRLFQRISTLRDPKVSIIPVLDQWITQGNTLKEPQFQRFVRELRARKRY 3 N L+ RIS L P +S++PVLDQW+ +G +++ + R +R+LR+RKRY Sbjct: 36 NINLYSRISPLGTPNLSLVPVLDQWVEEGKKVRDVELHRIIRDLRSRKRY 85 >ref|XP_003545936.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Glycine max] Length = 486 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/63 (41%), Positives = 40/63 (63%) Frame = -2 Query: 191 RSYSSPTQSKPNENSRLFQRISTLRDPKVSIIPVLDQWITQGNTLKEPQFQRFVRELRAR 12 RSY + KP+ L+ +IS L +P S++PVLD W+ +GN L+ + QR +R+LR R Sbjct: 11 RSYYTSRSKKPS----LYSKISPLGNPNTSVVPVLDDWVFKGNKLRVAELQRIIRDLRKR 66 Query: 11 KRY 3 R+ Sbjct: 67 SRF 69 >ref|XP_002517927.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542909|gb|EEF44445.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/66 (39%), Positives = 43/66 (65%) Frame = -2 Query: 200 LWLRSYSSPTQSKPNENSRLFQRISTLRDPKVSIIPVLDQWITQGNTLKEPQFQRFVREL 21 L+ + S S +E+S+L+ RI +RDPK SIIPVL+QW+++G+T+ + Q V + Sbjct: 31 LFFSTRSQTQSSSSSESSKLYDRIQIVRDPKESIIPVLNQWVSEGHTVGKALLQSLVHLM 90 Query: 20 RARKRY 3 + KR+ Sbjct: 91 KGYKRF 96