BLASTX nr result
ID: Cnidium21_contig00039253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039253 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285509.1| PREDICTED: GDSL esterase/lipase At3g26430 [V... 68 7e-10 ref|XP_004158356.1| PREDICTED: GDSL esterase/lipase At5g14450-li... 65 4e-09 ref|XP_004141199.1| PREDICTED: GDSL esterase/lipase At5g14450-li... 65 4e-09 ref|XP_002530042.1| Alpha-L-fucosidase 2 precursor, putative [Ri... 65 8e-09 ref|XP_002875320.1| GDSL-motif lipase/hydrolase family protein [... 64 2e-08 >ref|XP_002285509.1| PREDICTED: GDSL esterase/lipase At3g26430 [Vitis vinifera] gi|296081364|emb|CBI16797.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 221 SAVKCNIPAIYNFGDSNSDTGGLSAVFPPTVPPNGDTFFHIP 346 +A C+ PAI+NFGDSNSDTGGLSAV+ PPNG+TFFH P Sbjct: 24 TATSCDFPAIFNFGDSNSDTGGLSAVYGQAPPPNGETFFHKP 65 >ref|XP_004158356.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cucumis sativus] Length = 357 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 233 CNIPAIYNFGDSNSDTGGLSAVFPPTVPPNGDTFFH 340 CN PAIYNFGDSNSDTGG+SA F PT+ P G TFFH Sbjct: 7 CNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFH 42 >ref|XP_004141199.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cucumis sativus] Length = 352 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 233 CNIPAIYNFGDSNSDTGGLSAVFPPTVPPNGDTFFH 340 CN PAIYNFGDSNSDTGG+SA F PT+ P G TFFH Sbjct: 7 CNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFH 42 >ref|XP_002530042.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis] gi|223530458|gb|EEF32342.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis] Length = 390 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +2 Query: 233 CNIPAIYNFGDSNSDTGGLSAVFPPTVPPNGDTFFHIP 346 C+ PAI+NFGDSNSDTGGLSA F PPNG TFFH P Sbjct: 34 CHFPAIFNFGDSNSDTGGLSAAFGQAPPPNGHTFFHHP 71 >ref|XP_002875320.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] gi|297321158|gb|EFH51579.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] Length = 379 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = +2 Query: 233 CNIPAIYNFGDSNSDTGGLSAVFPPTVPPNGDTFFHIP 346 CN PAI+NFGDSNSDTGGLSA F PNG TFFH P Sbjct: 26 CNFPAIFNFGDSNSDTGGLSAAFGQAPYPNGQTFFHSP 63