BLASTX nr result
ID: Cnidium21_contig00039112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00039112 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512273.1| leucine-rich repeat-containing protein, puta... 55 8e-06 >ref|XP_002512273.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223548234|gb|EEF49725.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1166 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/92 (29%), Positives = 50/92 (54%), Gaps = 1/92 (1%) Frame = +2 Query: 2 NCNQLQTLEDLP-KIEEFSASGCPLLEKVTLKQGLSFERYAFPHKCVKLLEMESVFKVVP 178 NC LQ+L +LP + E +A C LE++T L C +L+E++ FK+ P Sbjct: 864 NCRSLQSLSELPASLRELNAENCTSLERITNLPNLMTSLRLNLAGCEQLVEVQGFFKLEP 923 Query: 179 IGEIDSELINSCGIYDVESMKRIRIRLYNYYT 274 I D E+ N G++++ ++ I++ +++ T Sbjct: 924 INNHDKEMANMLGLFNLGPVETIKVEMFSVMT 955