BLASTX nr result
ID: Cnidium21_contig00038996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038996 (552 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147305.1| PREDICTED: uncharacterized protein LOC101203... 64 2e-08 ref|XP_002264741.2| PREDICTED: uncharacterized protein LOC100249... 63 4e-08 emb|CBI18100.3| unnamed protein product [Vitis vinifera] 63 4e-08 gb|AAG51343.1|AC012562_4 hypothetical protein; 82071-85833 [Arab... 59 4e-07 ref|NP_187492.2| integrator complex subunit 4 [Arabidopsis thali... 59 4e-07 >ref|XP_004147305.1| PREDICTED: uncharacterized protein LOC101203415 [Cucumis sativus] gi|449501277|ref|XP_004161326.1| PREDICTED: uncharacterized protein LOC101225075 [Cucumis sativus] Length = 815 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 418 CFGGCISVRRWLLLNAKRILVRPAVLVTVFLGFSKDPYPEIRKVA 552 CFG +S R WLL NA++ +RP++L TVFLGF+KDPYP +RK A Sbjct: 24 CFGPSVSTRTWLLNNAEKFQLRPSLLFTVFLGFTKDPYPYVRKAA 68 >ref|XP_002264741.2| PREDICTED: uncharacterized protein LOC100249976 [Vitis vinifera] Length = 1007 Score = 62.8 bits (151), Expect = 4e-08 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +1 Query: 418 CFGGCISVRRWLLLNAKRILVRPAVLVTVFLGFSKDPYPEIRKVA 552 CFG +SVR W L NA R +RP VL+TV LGF+KDPYP +R+VA Sbjct: 135 CFGPSVSVRSWFLSNAFRFPIRPYVLLTVMLGFTKDPYPYVRRVA 179 >emb|CBI18100.3| unnamed protein product [Vitis vinifera] Length = 701 Score = 62.8 bits (151), Expect = 4e-08 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +1 Query: 418 CFGGCISVRRWLLLNAKRILVRPAVLVTVFLGFSKDPYPEIRKVA 552 CFG +SVR W L NA R +RP VL+TV LGF+KDPYP +R+VA Sbjct: 135 CFGPSVSVRSWFLSNAFRFPIRPYVLLTVMLGFTKDPYPYVRRVA 179 >gb|AAG51343.1|AC012562_4 hypothetical protein; 82071-85833 [Arabidopsis thaliana] Length = 768 Score = 59.3 bits (142), Expect = 4e-07 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 418 CFGGCISVRRWLLLNAKRILVRPAVLVTVFLGFSKDPYPEIRKVA 552 C G IS R WLL NA R V +VL T+FLGFSKDPYP IRKVA Sbjct: 135 CLGAPISSRLWLLRNADRFNVPSSVLFTLFLGFSKDPYPYIRKVA 179 >ref|NP_187492.2| integrator complex subunit 4 [Arabidopsis thaliana] gi|17473697|gb|AAL38305.1| unknown protein [Arabidopsis thaliana] gi|332641160|gb|AEE74681.1| integrator complex subunit 4 [Arabidopsis thaliana] Length = 936 Score = 59.3 bits (142), Expect = 4e-07 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 418 CFGGCISVRRWLLLNAKRILVRPAVLVTVFLGFSKDPYPEIRKVA 552 C G IS R WLL NA R V +VL T+FLGFSKDPYP IRKVA Sbjct: 135 CLGAPISSRLWLLRNADRFNVPSSVLFTLFLGFSKDPYPYIRKVA 179