BLASTX nr result
ID: Cnidium21_contig00038856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038856 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFJ66186.1| hypothetical protein 11M19.5 [Arabidopsis halleri] 55 6e-06 >gb|AFJ66186.1| hypothetical protein 11M19.5 [Arabidopsis halleri] Length = 1557 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/44 (50%), Positives = 28/44 (63%) Frame = -3 Query: 132 PHNFASRMTKVNFPKFDGTDLRSWLYKCNQFFQLDDIEESQKVR 1 P+ +R++KV FP FDG LR WLY+C QFF LD +VR Sbjct: 167 PNGLITRLSKVGFPSFDGNGLRGWLYRCEQFFSLDGTPPEMRVR 210