BLASTX nr result
ID: Cnidium21_contig00038825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038825 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34416.3| unnamed protein product [Vitis vinifera] 73 2e-11 ref|XP_002509887.1| conserved hypothetical protein [Ricinus comm... 73 2e-11 ref|XP_002299503.1| predicted protein [Populus trichocarpa] gi|2... 73 2e-11 ref|XP_002272229.1| PREDICTED: aluminum-activated malate transpo... 73 2e-11 ref|XP_002303616.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 >emb|CBI34416.3| unnamed protein product [Vitis vinifera] Length = 499 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 300 GRFRHFFRPWSEYVKVGAVLRYCAYEVMALLGLLHSIFQ 184 G+FRHFF PWSEYVKVGAVLRYCAYEVMAL G+LHS Q Sbjct: 296 GKFRHFFYPWSEYVKVGAVLRYCAYEVMALHGVLHSEIQ 334 >ref|XP_002509887.1| conserved hypothetical protein [Ricinus communis] gi|223549786|gb|EEF51274.1| conserved hypothetical protein [Ricinus communis] Length = 543 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 300 GRFRHFFRPWSEYVKVGAVLRYCAYEVMALLGLLHSIFQ 184 GRF+HFF PWSEYVKVGAVLRYCAYEVMAL G+LHS Q Sbjct: 294 GRFKHFFYPWSEYVKVGAVLRYCAYEVMALHGVLHSEIQ 332 >ref|XP_002299503.1| predicted protein [Populus trichocarpa] gi|222846761|gb|EEE84308.1| predicted protein [Populus trichocarpa] Length = 541 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 300 GRFRHFFRPWSEYVKVGAVLRYCAYEVMALLGLLHSIFQ 184 G+FRHFF PWSEYVKVGAVLRYCAYEVMAL G+LHS Q Sbjct: 294 GKFRHFFYPWSEYVKVGAVLRYCAYEVMALHGVLHSEIQ 332 >ref|XP_002272229.1| PREDICTED: aluminum-activated malate transporter 9 [Vitis vinifera] Length = 535 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 300 GRFRHFFRPWSEYVKVGAVLRYCAYEVMALLGLLHSIFQ 184 G+FRHFF PWSEYVKVGAVLRYCAYEVMAL G+LHS Q Sbjct: 296 GKFRHFFYPWSEYVKVGAVLRYCAYEVMALHGVLHSEIQ 334 >ref|XP_002303616.1| predicted protein [Populus trichocarpa] gi|222841048|gb|EEE78595.1| predicted protein [Populus trichocarpa] Length = 513 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 300 GRFRHFFRPWSEYVKVGAVLRYCAYEVMALLGLLHSIFQ 184 GRF+HFF PWSEYVKVGAVLRYCAYEVMAL G+LHS Q Sbjct: 265 GRFQHFFYPWSEYVKVGAVLRYCAYEVMALHGVLHSEIQ 303