BLASTX nr result
ID: Cnidium21_contig00038804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038804 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002406560.1| heat shock protein 70, putative [Ixodes scap... 55 8e-06 >ref|XP_002406560.1| heat shock protein 70, putative [Ixodes scapularis] gi|215492006|gb|EEC01647.1| heat shock protein 70, putative [Ixodes scapularis] Length = 212 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/84 (36%), Positives = 53/84 (63%), Gaps = 2/84 (2%) Frame = +1 Query: 58 EMSIEVCKLVKQIAIEEMPWIILAKMEESLVAFID--MADKRVILSACVNVSQKQRIRDV 231 ++S+E+ K+ EE+ ++LAKM+E+ AF+ ++D V + AC N SQ+Q +D Sbjct: 107 KISVELKGERKRFHPEEISAMVLAKMKETAEAFLGRKVSDAVVTVPACFNNSQRQATKDA 166 Query: 232 NVMHGRFMMQIMNEPTSITNTYGL 303 V+ G +++I+NEPT+ YGL Sbjct: 167 GVIAGLNVLRIINEPTAAALAYGL 190