BLASTX nr result
ID: Cnidium21_contig00038770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038770 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002866046.1| hypothetical protein ARALYDRAFT_918581 [Arab... 80 2e-13 ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6,... 79 3e-13 ref|XP_002319260.1| GH3 family protein [Populus trichocarpa] gi|... 79 4e-13 ref|NP_200262.1| indole-3-acetic acid-amido synthetase GH3.6 [Ar... 79 5e-13 ref|NP_194456.1| indole-3-acetic acid-amido synthetase GH3.5 [Ar... 78 6e-13 >ref|XP_002866046.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. lyrata] gi|297311881|gb|EFH42305.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. lyrata] Length = 612 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -2 Query: 362 KTPRCVTFAPHVELLNSRVVCSYFSPKCPKWAPGHKQW 249 KTPRCV FAP +ELLNSRVV SYFSPKCPKWAPGHKQW Sbjct: 572 KTPRCVKFAPIIELLNSRVVDSYFSPKCPKWAPGHKQW 609 >ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] gi|223526345|gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] Length = 612 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -2 Query: 362 KTPRCVTFAPHVELLNSRVVCSYFSPKCPKWAPGHKQW 249 KTPRCV FAP VELLNSRVV SYFSPKCPKW PGHKQW Sbjct: 571 KTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGHKQW 608 >ref|XP_002319260.1| GH3 family protein [Populus trichocarpa] gi|222857636|gb|EEE95183.1| GH3 family protein [Populus trichocarpa] Length = 611 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -2 Query: 362 KTPRCVTFAPHVELLNSRVVCSYFSPKCPKWAPGHKQW 249 KTPRCV FAP VELLNSRVV YFSPKCPKWAPGHKQW Sbjct: 571 KTPRCVKFAPIVELLNSRVVTCYFSPKCPKWAPGHKQW 608 >ref|NP_200262.1| indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana] gi|62900334|sp|Q9LSQ4.1|GH36_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.6; AltName: Full=Auxin-responsive GH3-like protein 6; Short=AtGH3-6; AltName: Full=Protein DWARF IN LIGHT 1; Short=DFL-1 gi|8885594|dbj|BAA97524.1| auxin-responsive-like protein [Arabidopsis thaliana] gi|11041726|dbj|BAB17304.1| auxin-responsive GH3 homologue [Arabidopsis thaliana] gi|59958336|gb|AAX12878.1| At5g54510 [Arabidopsis thaliana] gi|209414530|gb|ACI46505.1| At5g54510 [Arabidopsis thaliana] gi|332009121|gb|AED96504.1| indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana] Length = 612 Score = 78.6 bits (192), Expect = 5e-13 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 362 KTPRCVTFAPHVELLNSRVVCSYFSPKCPKWAPGHKQW 249 KTPRCV FAP +ELLNSRVV SYFSPKCPKW+PGHKQW Sbjct: 572 KTPRCVKFAPIIELLNSRVVDSYFSPKCPKWSPGHKQW 609 >ref|NP_194456.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana] gi|62900128|sp|O81829.1|GH35_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.5; AltName: Full=Auxin-responsive GH3-like protein 5; Short=AtGH3-5 gi|3269287|emb|CAA19720.1| GH3 like protein [Arabidopsis thaliana] gi|7269579|emb|CAB79581.1| GH3 like protein [Arabidopsis thaliana] gi|17979055|gb|AAL49795.1| putative GH3 protein [Arabidopsis thaliana] gi|20465961|gb|AAM20166.1| putative GH3 protein [Arabidopsis thaliana] gi|98621984|gb|ABF58888.1| auxin-responsive GH3-like [Arabidopsis thaliana] gi|332659918|gb|AEE85318.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana] Length = 612 Score = 78.2 bits (191), Expect = 6e-13 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -2 Query: 362 KTPRCVTFAPHVELLNSRVVCSYFSPKCPKWAPGHKQW 249 KTPRCV FAP +ELLNSRVV SYFSPKCPKW PGHKQW Sbjct: 572 KTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQW 609