BLASTX nr result
ID: Cnidium21_contig00038729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038729 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22748.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 ref|XP_004140840.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 emb|CAC36392.1| hypothetical protein [Capsella rubella] 58 7e-07 >emb|CBI22748.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 355 LVYNTLVRCLRNAGKLSEAHKVIRTMVEKGKYAHLISK 242 LVYNTLV LRNAGKL EAH+VIR MV+KG+Y HL+SK Sbjct: 474 LVYNTLVGNLRNAGKLKEAHEVIRHMVDKGQYVHLLSK 511 >ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Vitis vinifera] Length = 514 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 355 LVYNTLVRCLRNAGKLSEAHKVIRTMVEKGKYAHLISK 242 LVYNTLV LRNAGKL EAH+VIR MV+KG+Y HL+SK Sbjct: 470 LVYNTLVGNLRNAGKLKEAHEVIRHMVDKGQYVHLLSK 507 >ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cucumis sativus] Length = 476 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 355 LVYNTLVRCLRNAGKLSEAHKVIRTMVEKGKYAHLISK 242 LVY+TLV LRNAGKL EAHKVI+ MVE G+YAHL++K Sbjct: 432 LVYSTLVSYLRNAGKLGEAHKVIKRMVENGQYAHLMTK 469 >ref|XP_004140840.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cucumis sativus] Length = 476 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 355 LVYNTLVRCLRNAGKLSEAHKVIRTMVEKGKYAHLISK 242 LVY+TLV LRNAGKL EAHKVI+ MVE G+YAHL++K Sbjct: 432 LVYSTLVSYLRNAGKLGEAHKVIKQMVENGQYAHLMTK 469 >emb|CAC36392.1| hypothetical protein [Capsella rubella] Length = 150 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 355 LVYNTLVRCLRNAGKLSEAHKVIRTMVEKGKYAHLISK 242 +VY+TLV LRNAGKL EAH+V++ MVEKG YAHL+SK Sbjct: 106 VVYSTLVNNLRNAGKLLEAHEVVKDMVEKGHYAHLLSK 143