BLASTX nr result
ID: Cnidium21_contig00038677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038677 (555 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521484.1| acetylglucosaminyltransferase, putative [Ric... 79 6e-13 ref|NP_176955.1| beta-1,4-N-acetylglucosaminyltransferase like p... 79 6e-13 ref|XP_003555004.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-... 78 8e-13 ref|XP_003553455.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-... 78 1e-12 ref|XP_003525041.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-... 78 1e-12 >ref|XP_002521484.1| acetylglucosaminyltransferase, putative [Ricinus communis] gi|223539383|gb|EEF40974.1| acetylglucosaminyltransferase, putative [Ricinus communis] Length = 387 Score = 78.6 bits (192), Expect = 6e-13 Identities = 33/45 (73%), Positives = 42/45 (93%) Frame = +1 Query: 1 EEFTFTDIIKRMGPIPHSYSAVHLPLYVLDNADRYRYLLPGSCRR 135 EE+TF +II +MGPIPHSYSAVHLP ++L+NAD+YRYLLPG+C+R Sbjct: 340 EEYTFKEIIGKMGPIPHSYSAVHLPSHLLNNADKYRYLLPGNCQR 384 >ref|NP_176955.1| beta-1,4-N-acetylglucosaminyltransferase like protein [Arabidopsis thaliana] gi|12324065|gb|AAG51993.1|AC012563_3 unknown protein; 88937-90309 [Arabidopsis thaliana] gi|19310605|gb|AAL85033.1| unknown protein [Arabidopsis thaliana] gi|110741082|dbj|BAE98635.1| hypothetical protein [Arabidopsis thaliana] gi|332196593|gb|AEE34714.1| beta-1,4-N-acetylglucosaminyltransferase like protein [Arabidopsis thaliana] Length = 390 Score = 78.6 bits (192), Expect = 6e-13 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +1 Query: 1 EEFTFTDIIKRMGPIPHSYSAVHLPLYVLDNADRYRYLLPGSCRR 135 EE+TF DII +MGPIPHSYSAVHLP Y+L+NA+RY++LLPG+C R Sbjct: 343 EEYTFKDIIGKMGPIPHSYSAVHLPAYLLENAERYKFLLPGNCLR 387 >ref|XP_003555004.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like [Glycine max] Length = 383 Score = 78.2 bits (191), Expect = 8e-13 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +1 Query: 1 EEFTFTDIIKRMGPIPHSYSAVHLPLYVLDNADRYRYLLPGSCRR 135 EE+TF DII ++GPIPHSYSAVHLP Y+L+NA++Y++LLPG+CRR Sbjct: 336 EEYTFKDIIGKLGPIPHSYSAVHLPSYLLNNAEKYKFLLPGNCRR 380 >ref|XP_003553455.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like [Glycine max] Length = 387 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +1 Query: 1 EEFTFTDIIKRMGPIPHSYSAVHLPLYVLDNADRYRYLLPGSCRR 135 EE+TF +II ++GPIPHSYSAVHLP Y+L+NA+R+R+LLPG+CRR Sbjct: 340 EEYTFKEIIGKLGPIPHSYSAVHLPAYLLNNAERFRFLLPGNCRR 384 >ref|XP_003525041.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like [Glycine max] Length = 391 Score = 77.8 bits (190), Expect = 1e-12 Identities = 31/45 (68%), Positives = 42/45 (93%) Frame = +1 Query: 1 EEFTFTDIIKRMGPIPHSYSAVHLPLYVLDNADRYRYLLPGSCRR 135 EE+TF DII +MGPIPHSYSAVHLP ++L+N+D+Y++LLPG+C+R Sbjct: 345 EEYTFRDIIGKMGPIPHSYSAVHLPAFLLENSDKYKFLLPGNCKR 389