BLASTX nr result
ID: Cnidium21_contig00038588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038588 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-C... 62 4e-08 ref|NP_001234658.1| peroxisomal acyl-CoA oxidase 1B [Solanum lyc... 61 1e-07 gb|AAW78691.1| peroxisomal acyl-CoA oxidase 1A [Solanum cheesman... 60 1e-07 ref|NP_001234198.1| peroxisomal acyl-CoA oxidase 1A [Solanum lyc... 60 1e-07 pdb|1W07|A Chain A, Arabidopsis Thaliana Acyl-Coa Oxidase 1 gi|5... 59 3e-07 >pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) gi|109157677|pdb|2FON|B Chain B, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) gi|109157678|pdb|2FON|C Chain C, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) Length = 683 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 112 EMEGIDYLADERRKAEFDVDAMKIVWAGSKQAFHLVD 2 EMEG+DYLADER+KA FDVD MKIVWAGS+ F L D Sbjct: 19 EMEGVDYLADERKKAGFDVDEMKIVWAGSRHDFELTD 55 >ref|NP_001234658.1| peroxisomal acyl-CoA oxidase 1B [Solanum lycopersicum] gi|58531950|gb|AAW78690.1| peroxisomal acyl-CoA oxidase 1B [Solanum lycopersicum] Length = 649 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -2 Query: 109 MEGIDYLADERRKAEFDVDAMKIVWAGSKQAFHLVD 2 MEGIDYLA+ER+KAEF+VD MKIVWAGS++AF + D Sbjct: 1 MEGIDYLAEERKKAEFNVDEMKIVWAGSRRAFEVSD 36 >gb|AAW78691.1| peroxisomal acyl-CoA oxidase 1A [Solanum cheesmaniae] Length = 664 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 109 MEGIDYLADERRKAEFDVDAMKIVWAGSKQAFHLVD 2 MEG+DYLADER+KA FDVD MKIVWAGS+ F L D Sbjct: 1 MEGVDYLADERKKAGFDVDEMKIVWAGSRHDFELTD 36 >ref|NP_001234198.1| peroxisomal acyl-CoA oxidase 1A [Solanum lycopersicum] gi|58531948|gb|AAW78689.1| peroxisomal acyl-CoA oxidase 1A [Solanum lycopersicum] Length = 664 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 109 MEGIDYLADERRKAEFDVDAMKIVWAGSKQAFHLVD 2 MEG+DYLADER+KA FDVD MKIVWAGS+ F L D Sbjct: 1 MEGVDYLADERKKAGFDVDEMKIVWAGSRHDFELTD 36 >pdb|1W07|A Chain A, Arabidopsis Thaliana Acyl-Coa Oxidase 1 gi|58177067|pdb|1W07|B Chain B, Arabidopsis Thaliana Acyl-Coa Oxidase 1 Length = 659 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 109 MEGIDYLADERRKAEFDVDAMKIVWAGSKQAFHLVD 2 MEGID+LADER KAEFDV+ MKIVWAGS+ AF + D Sbjct: 1 MEGIDHLADERNKAEFDVEDMKIVWAGSRHAFEVSD 36