BLASTX nr result
ID: Cnidium21_contig00038520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038520 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277052.1| PREDICTED: uncharacterized protein C22orf13 ... 63 2e-08 ref|NP_001234334.1| guanylyl cyclase [Solanum lycopersicum] gi|1... 61 8e-08 ref|XP_002524259.1| Protein C22orf13, putative [Ricinus communis... 60 1e-07 ref|XP_002311194.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|NP_001236262.1| guanylyl cyclase [Glycine max] gi|116668552|... 59 5e-07 >ref|XP_002277052.1| PREDICTED: uncharacterized protein C22orf13 homolog [Vitis vinifera] gi|296086142|emb|CBI31583.3| unnamed protein product [Vitis vinifera] Length = 280 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 335 PASSRKHGRITSKCLEEARKSFGTDEDLLLVSMAK 231 PASSRKH RI+S CLEEARKSFGTDEDLLL+SM K Sbjct: 231 PASSRKHERISSNCLEEARKSFGTDEDLLLISMEK 265 >ref|NP_001234334.1| guanylyl cyclase [Solanum lycopersicum] gi|116668554|gb|ABK15531.1| guanylyl cyclase [Solanum lycopersicum] Length = 275 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -1 Query: 335 PASSRKHGRITSKCLEEARKSFGTDEDLLLVSMAKRNN*EPSH 207 PASSRK+GR+TSKCLE+ARKSFGTDEDLLL+ + +R + SH Sbjct: 225 PASSRKYGRVTSKCLEKARKSFGTDEDLLLIRV-EREEAKSSH 266 >ref|XP_002524259.1| Protein C22orf13, putative [Ricinus communis] gi|223536536|gb|EEF38183.1| Protein C22orf13, putative [Ricinus communis] Length = 299 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -1 Query: 335 PASSRKHGRITSKCLEEARKSFGTDEDLLLVSMAKRNN*EPSHS 204 PASSR RI+SKCLEEARKSFGTDEDLLL+S+ K N + S S Sbjct: 198 PASSRISERISSKCLEEARKSFGTDEDLLLISLEKSNEQQNSSS 241 >ref|XP_002311194.1| predicted protein [Populus trichocarpa] gi|222851014|gb|EEE88561.1| predicted protein [Populus trichocarpa] Length = 269 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 335 PASSRKHGRITSKCLEEARKSFGTDEDLLLVSM 237 PA+SRKH R++S+CLEEARKSFGTDEDLLL+S+ Sbjct: 228 PAASRKHERMSSRCLEEARKSFGTDEDLLLISL 260 >ref|NP_001236262.1| guanylyl cyclase [Glycine max] gi|116668552|gb|ABK15530.1| guanylyl cyclase [Glycine max] Length = 281 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 335 PASSRKHGRITSKCLEEARKSFGTDEDLLLVSMAKRNN 222 P SS+KH RI+SK LEEARK+FGTDEDLLL+S+ K +N Sbjct: 228 PGSSKKHKRISSKSLEEARKAFGTDEDLLLISLEKSSN 265