BLASTX nr result
ID: Cnidium21_contig00038357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038357 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155878.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 ref|XP_004134328.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_004155878.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cucumis sativus] Length = 561 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -2 Query: 422 NEVHEFTVVDKSHPKSVRIYQMINGLSQHLKKDGCTAN 309 NEVHEFTV D+SHPKS IYQ+INGL LK+ C +N Sbjct: 522 NEVHEFTVFDRSHPKSDNIYQVINGLRHELKQVECFSN 559 >ref|XP_004134328.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cucumis sativus] Length = 601 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -2 Query: 422 NEVHEFTVVDKSHPKSVRIYQMINGLSQHLKKDGCTAN 309 NEVHEFTV D+SHPKS IYQ+INGL LK+ C +N Sbjct: 562 NEVHEFTVFDRSHPKSDNIYQVINGLRHELKQVECFSN 599