BLASTX nr result
ID: Cnidium21_contig00038214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038214 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280618.1| PREDICTED: heat stress transcription factor ... 63 2e-08 ref|XP_003554271.1| PREDICTED: heat stress transcription factor ... 61 1e-07 ref|XP_002520943.1| DNA binding protein, putative [Ricinus commu... 61 1e-07 ref|XP_004146995.1| PREDICTED: heat stress transcription factor ... 56 3e-06 ref|XP_004145415.1| PREDICTED: heat stress transcription factor ... 56 3e-06 >ref|XP_002280618.1| PREDICTED: heat stress transcription factor A-6b [Vitis vinifera] Length = 361 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = -1 Query: 144 MNNSYPVKKEYSGSSSS--TGDPPEMVLQPQPMEGLNEIGPPPFLNKTFD 1 MN YPVK+E+ GSSSS +G+PP + PQP+EGL++ GPPPFL KTFD Sbjct: 1 MNPMYPVKEEFPGSSSSPQSGEPPVV---PQPVEGLHDAGPPPFLTKTFD 47 >ref|XP_003554271.1| PREDICTED: heat stress transcription factor A-6b-like [Glycine max] Length = 370 Score = 60.8 bits (146), Expect = 1e-07 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 7/55 (12%) Frame = -1 Query: 144 MNNSYPVKKEY------SGSSSSTG-DPPEMVLQPQPMEGLNEIGPPPFLNKTFD 1 MN YPVK+EY S SS +TG D MV P+PMEGL+EIGPPPFL KT+D Sbjct: 1 MNYLYPVKEEYLESPPPSSSSPTTGVDESAMVPPPRPMEGLHEIGPPPFLTKTYD 55 >ref|XP_002520943.1| DNA binding protein, putative [Ricinus communis] gi|223539780|gb|EEF41360.1| DNA binding protein, putative [Ricinus communis] Length = 360 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/53 (56%), Positives = 40/53 (75%), Gaps = 4/53 (7%) Frame = -1 Query: 147 VMNNSYPVKKEYSG-SSSSTGDPP---EMVLQPQPMEGLNEIGPPPFLNKTFD 1 +MN + VK+EY+G SSS +GD P +M + PQPMEGL++ GPPPFL KTF+ Sbjct: 1 MMNPYFTVKEEYAGLSSSQSGDEPPLAQMQIPPQPMEGLHDTGPPPFLTKTFE 53 >ref|XP_004146995.1| PREDICTED: heat stress transcription factor A-6b-like [Cucumis sativus] gi|449491566|ref|XP_004158938.1| PREDICTED: heat stress transcription factor A-6b-like [Cucumis sativus] Length = 374 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -1 Query: 144 MNNSYPVKKEYSGSSSST--GDPPEMVLQPQPMEGLNEIGPPPFLNKTFD 1 MN +P+K+E+ GSSSS G+ ++ P PMEGL++ GPPPFL KTF+ Sbjct: 5 MNPLFPIKEEFPGSSSSDVDGERSAVLTPPVPMEGLHDAGPPPFLTKTFE 54 >ref|XP_004145415.1| PREDICTED: heat stress transcription factor A-2d-like [Cucumis sativus] Length = 348 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -1 Query: 144 MNNSYPVKKEYSGSSSSTGDPPEMVLQPQPMEGLNEIGPPPFLNKTFD 1 MN YPVK+E G SSS + PQPMEGLN++ PPPFL KTFD Sbjct: 1 MNPQYPVKEEDWGPSSSEFGGYGLPPTPQPMEGLNDVSPPPFLIKTFD 48