BLASTX nr result
ID: Cnidium21_contig00038209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038209 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596959.1| L-ascorbate oxidase-like protein [Medicago t... 70 1e-10 ref|XP_003596958.1| L-ascorbate oxidase-like protein [Medicago t... 70 1e-10 ref|XP_003539859.1| PREDICTED: L-ascorbate oxidase homolog [Glyc... 70 2e-10 ref|XP_003527501.1| PREDICTED: L-ascorbate oxidase homolog [Glyc... 70 2e-10 ref|XP_003540295.1| PREDICTED: L-ascorbate oxidase homolog [Glyc... 65 7e-09 >ref|XP_003596959.1| L-ascorbate oxidase-like protein [Medicago truncatula] gi|355486007|gb|AES67210.1| L-ascorbate oxidase-like protein [Medicago truncatula] Length = 458 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 FYLRVYSPANSWRDEYPIPSNALRCGQAVGH 95 FYLRVYSPANSWRDEYPIPSNALRCG+AVGH Sbjct: 428 FYLRVYSPANSWRDEYPIPSNALRCGRAVGH 458 >ref|XP_003596958.1| L-ascorbate oxidase-like protein [Medicago truncatula] gi|124360517|gb|ABN08527.1| Multicopper oxidase, type 1 [Medicago truncatula] gi|355486006|gb|AES67209.1| L-ascorbate oxidase-like protein [Medicago truncatula] Length = 539 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 FYLRVYSPANSWRDEYPIPSNALRCGQAVGH 95 FYLRVYSPANSWRDEYPIPSNALRCG+AVGH Sbjct: 509 FYLRVYSPANSWRDEYPIPSNALRCGRAVGH 539 >ref|XP_003539859.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max] Length = 537 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 FYLRVYSPANSWRDEYPIPSNALRCGQAVGH 95 FYLRVYSPANSWRDEYPIPSNA+RCG+AVGH Sbjct: 506 FYLRVYSPANSWRDEYPIPSNAIRCGKAVGH 536 >ref|XP_003527501.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max] Length = 537 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 FYLRVYSPANSWRDEYPIPSNALRCGQAVGH 95 FYLRVYSPANSWRDEYPIPSNA+RCG+AVGH Sbjct: 506 FYLRVYSPANSWRDEYPIPSNAIRCGKAVGH 536 >ref|XP_003540295.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max] Length = 536 Score = 64.7 bits (156), Expect = 7e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 FYLRVYSPANSWRDEYPIPSNALRCGQAVGH 95 FYL VYSPANSWRDEYPIPSNAL CG+A+GH Sbjct: 506 FYLGVYSPANSWRDEYPIPSNALLCGRAIGH 536