BLASTX nr result
ID: Cnidium21_contig00038083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038083 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273543.1| PREDICTED: sirohydrochlorin ferrochelatase-l... 66 3e-09 ref|XP_002524661.1| sirohydrochlorin ferrochelatase, putative [R... 66 3e-09 emb|CBI34882.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|XP_002299633.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 emb|CAN60425.1| hypothetical protein VITISV_021073 [Vitis vinifera] 65 6e-09 >ref|XP_002273543.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Vitis vinifera] Length = 208 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 219 ELAEPFIEDAFASCMQQGANRVIVNPFFMFPGRHW 323 ELAEP I +AF+SC+QQGANRVIV+PFF+FPGRHW Sbjct: 108 ELAEPSITNAFSSCVQQGANRVIVSPFFLFPGRHW 142 >ref|XP_002524661.1| sirohydrochlorin ferrochelatase, putative [Ricinus communis] gi|223536022|gb|EEF37680.1| sirohydrochlorin ferrochelatase, putative [Ricinus communis] Length = 210 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 219 ELAEPFIEDAFASCMQQGANRVIVNPFFMFPGRHW 323 ELAEP I+DAF C+QQGANRVIV+PFF+FPGRHW Sbjct: 110 ELAEPSIKDAFGLCVQQGANRVIVSPFFLFPGRHW 144 >emb|CBI34882.3| unnamed protein product [Vitis vinifera] Length = 124 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 219 ELAEPFIEDAFASCMQQGANRVIVNPFFMFPGRHW 323 ELAEP I +AF+SC+QQGANRVIV+PFF+FPGRHW Sbjct: 24 ELAEPSITNAFSSCVQQGANRVIVSPFFLFPGRHW 58 >ref|XP_002299633.1| predicted protein [Populus trichocarpa] gi|222846891|gb|EEE84438.1| predicted protein [Populus trichocarpa] Length = 156 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 219 ELAEPFIEDAFASCMQQGANRVIVNPFFMFPGRHW 323 ELAEP I DAF C+QQGANRVIV+PFF+FPGRHW Sbjct: 56 ELAEPSIRDAFGLCVQQGANRVIVSPFFLFPGRHW 90 >emb|CAN60425.1| hypothetical protein VITISV_021073 [Vitis vinifera] Length = 150 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 219 ELAEPFIEDAFASCMQQGANRVIVNPFFMFPGRHW 323 ELAEP I +AF SC+QQGANRVIV+PFF+FPGRHW Sbjct: 45 ELAEPSITNAFNSCVQQGANRVIVSPFFLFPGRHW 79