BLASTX nr result
ID: Cnidium21_contig00038027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038027 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002886462.1| binding protein [Arabidopsis lyrata subsp. l... 55 8e-06 >ref|XP_002886462.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297332303|gb|EFH62721.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 550 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/44 (54%), Positives = 35/44 (79%) Frame = +2 Query: 212 EPLNLFHQMVKMQPVPSIIEFNRLLSALVKMKEYSVSVFVFRDM 343 + +NLF +MVK +P PSI++FNRLLSA+VKMK+Y V + + + M Sbjct: 68 DAINLFREMVKTRPFPSIVDFNRLLSAIVKMKKYDVVISLGKKM 111