BLASTX nr result
ID: Cnidium21_contig00038025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00038025 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635424.1| PREDICTED: LOW QUALITY PROTEIN: putative rib... 87 1e-15 ref|XP_002518871.1| conserved hypothetical protein [Ricinus comm... 76 3e-12 emb|CAN63032.1| hypothetical protein VITISV_024672 [Vitis vinifera] 73 3e-11 ref|XP_002522452.1| nucleic acid binding protein, putative [Rici... 72 6e-11 emb|CAB75484.1| putative protein [Arabidopsis thaliana] 71 1e-10 >ref|XP_003635424.1| PREDICTED: LOW QUALITY PROTEIN: putative ribonuclease H protein At1g65750-like [Vitis vinifera] Length = 820 Score = 87.0 bits (214), Expect = 1e-15 Identities = 36/91 (39%), Positives = 52/91 (57%) Frame = -2 Query: 301 WRKLWNLKIPSKVKNFLWRAASNCLPTKDLLRSKRVPVNSVCPSCNEAAETILHSLVTCP 122 W +LW + P K+ NF WRAA NCLPT+ L + V CP C ET LH+LV C Sbjct: 508 WAQLWKVTAPPKILNFAWRAARNCLPTRFALTIRHVDTPMCCPICRSELETTLHALVECV 567 Query: 121 FAQSCWYQAAVPAITGEFTTFLEWLQLVFTH 29 A+ W ++ + + G F +F++WL +F + Sbjct: 568 AARDVWDESGLAMLQGNFGSFVDWLATMFAY 598 >ref|XP_002518871.1| conserved hypothetical protein [Ricinus communis] gi|223541858|gb|EEF43404.1| conserved hypothetical protein [Ricinus communis] Length = 668 Score = 75.9 bits (185), Expect = 3e-12 Identities = 30/67 (44%), Positives = 41/67 (61%) Frame = -2 Query: 304 FWRKLWNLKIPSKVKNFLWRAASNCLPTKDLLRSKRVPVNSVCPSCNEAAETILHSLVTC 125 FW K W LKIP+KV+N +W+ SNC+ T LR + V ++ +C CN ET+ H L C Sbjct: 427 FWNKFWKLKIPTKVRNLMWKICSNCIRTAMNLRMRYVDLDPLCKWCNREPETLFHVLFGC 486 Query: 124 PFAQSCW 104 A+ CW Sbjct: 487 SMARECW 493 >emb|CAN63032.1| hypothetical protein VITISV_024672 [Vitis vinifera] Length = 1413 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/74 (41%), Positives = 41/74 (55%) Frame = -2 Query: 301 WRKLWNLKIPSKVKNFLWRAASNCLPTKDLLRSKRVPVNSVCPSCNEAAETILHSLVTCP 122 W +LW + P K+ NF WRAA NCLPT+ L + V CP C ET LH+LV C Sbjct: 1238 WAQLWKVTTPPKILNFAWRAARNCLPTRFALTIRHVDTPMCCPICRSEPETTLHALVECV 1297 Query: 121 FAQSCWYQAAVPAI 80 + W ++ V A+ Sbjct: 1298 ATRDVWDESVVEAL 1311 >ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis] gi|223538337|gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis] Length = 483 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/91 (37%), Positives = 47/91 (51%) Frame = -2 Query: 301 WRKLWNLKIPSKVKNFLWRAASNCLPTKDLLRSKRVPVNSVCPSCNEAAETILHSLVTCP 122 WR+LW L I +K K F+WRA +N LP + L ++V +S CP C ETI+H LV C Sbjct: 184 WRRLWKLNIAAKCKVFMWRALTNRLPVRTNLVMRKVTEDSSCPCCVSQPETIMHILVLCD 243 Query: 121 FAQSCWYQAAVPAITGEFTTFLEWLQLVFTH 29 W + + + LE + VF H Sbjct: 244 VTTQSWKYVNLYQFLSQVSNLLEGARSVFEH 274 >emb|CAB75484.1| putative protein [Arabidopsis thaliana] Length = 851 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/70 (44%), Positives = 42/70 (60%) Frame = -2 Query: 295 KLWNLKIPSKVKNFLWRAASNCLPTKDLLRSKRVPVNSVCPSCNEAAETILHSLVTCPFA 116 K+WNL I K+K+FLWR S LPT D L ++ + ++ CP C E+I H+L TCPFA Sbjct: 666 KIWNLPIMPKLKHFLWRILSKALPTTDRLTTRGMRIDPGCPRCRRENESINHALFTCPFA 725 Query: 115 QSCWYQAAVP 86 W + P Sbjct: 726 TMAWRLSDTP 735