BLASTX nr result
ID: Cnidium21_contig00037889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00037889 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611775.1| hypothetical protein MTR_5g017710 [Medicago ... 55 5e-06 >ref|XP_003611775.1| hypothetical protein MTR_5g017710 [Medicago truncatula] gi|355513110|gb|AES94733.1| hypothetical protein MTR_5g017710 [Medicago truncatula] Length = 85 Score = 55.5 bits (132), Expect = 5e-06 Identities = 34/91 (37%), Positives = 47/91 (51%) Frame = -3 Query: 380 MTKFSGIVLFFLVLILANEVANIEGRKVALGKKSQTAAVKVMSLAEEGKVRGSTSSVASP 201 M F+ L F++L+++ E+ +IEGR + S AA + E R S Sbjct: 1 MAHFTRSCLIFVLLLISCELLSIEGRSLRKSIGSPKAA------SVETMTRSVVLSPRQL 54 Query: 200 SQNGGQISTQDAGDVDAFRPTTPGHSPGIGH 108 NG + G V+AFRPTTPGHSPG+GH Sbjct: 55 QNNGRNLE----GSVEAFRPTTPGHSPGVGH 81