BLASTX nr result
ID: Cnidium21_contig00037807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00037807 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66140.1| hypothetical protein [Beta vulgaris subsp. vulga... 40 2e-06 >emb|CCA66140.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1381 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 15/39 (38%), Positives = 26/39 (66%) Frame = +2 Query: 221 SLLTWNIRGMNNRIARKKLRKFIQKEDPWVILIQDKNVK 337 S+++WN+RG+ +R R LRK I K +P + IQ+ ++ Sbjct: 2 SVISWNVRGLGSRAKRSSLRKHITKHEPTFVFIQETKME 40 Score = 36.2 bits (82), Expect(2) = 2e-06 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +1 Query: 328 KCEEVSGNMKDSVW-DDFHDWLISASQGQSGGLATTWD 438 K EE+ + S+W D +W+IS SQG SGG+ + W+ Sbjct: 38 KMEEMPEKIMRSIWKSDNVEWIISPSQGNSGGILSIWN 75