BLASTX nr result
ID: Cnidium21_contig00037579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00037579 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529042.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_002298851.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_003551516.1| PREDICTED: uncharacterized protein LOC100796... 55 6e-06 ref|XP_003600249.1| hypothetical protein MTR_3g055960 [Medicago ... 55 6e-06 gb|ACU18793.1| unknown [Glycine max] 55 6e-06 >ref|XP_002529042.1| conserved hypothetical protein [Ricinus communis] gi|223531522|gb|EEF33353.1| conserved hypothetical protein [Ricinus communis] Length = 429 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/55 (52%), Positives = 33/55 (60%) Frame = -3 Query: 364 YMKSMQEFTDSLAKMKLPMDVXXXXXXXXXXXXXXXXXXXXTPSSRVFYGSRAFF 200 YMKSMQ+FT+SLAKMKLP+D+ SSRVFYGSRAFF Sbjct: 375 YMKSMQQFTESLAKMKLPLDIDSGPTSSGSSTSDQKMQSSKNSSSRVFYGSRAFF 429 >ref|XP_002298851.1| predicted protein [Populus trichocarpa] gi|222846109|gb|EEE83656.1| predicted protein [Populus trichocarpa] Length = 432 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/55 (52%), Positives = 33/55 (60%) Frame = -3 Query: 364 YMKSMQEFTDSLAKMKLPMDVXXXXXXXXXXXXXXXXXXXXTPSSRVFYGSRAFF 200 YMKSMQ+FT+SLAKMKLP+D+ SSRVFYGSRAFF Sbjct: 378 YMKSMQQFTESLAKMKLPLDIDSGPTSSGSSSSDQKMQASKNTSSRVFYGSRAFF 432 >ref|XP_003551516.1| PREDICTED: uncharacterized protein LOC100796499 isoform 1 [Glycine max] gi|356566598|ref|XP_003551517.1| PREDICTED: uncharacterized protein LOC100796499 isoform 2 [Glycine max] gi|356566600|ref|XP_003551518.1| PREDICTED: uncharacterized protein LOC100796499 isoform 3 [Glycine max] gi|356566602|ref|XP_003551519.1| PREDICTED: uncharacterized protein LOC100796499 isoform 4 [Glycine max] Length = 428 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/55 (52%), Positives = 34/55 (61%) Frame = -3 Query: 364 YMKSMQEFTDSLAKMKLPMDVXXXXXXXXXXXXXXXXXXXXTPSSRVFYGSRAFF 200 YMKSMQ+FT+SLAKMKLPMD+ + +SRVFYGSRAFF Sbjct: 374 YMKSMQQFTESLAKMKLPMDLESEPTSSGNSTTEQKLQPSKSNNSRVFYGSRAFF 428 >ref|XP_003600249.1| hypothetical protein MTR_3g055960 [Medicago truncatula] gi|355489297|gb|AES70500.1| hypothetical protein MTR_3g055960 [Medicago truncatula] Length = 430 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/55 (50%), Positives = 33/55 (60%) Frame = -3 Query: 364 YMKSMQEFTDSLAKMKLPMDVXXXXXXXXXXXXXXXXXXXXTPSSRVFYGSRAFF 200 YMKSMQ+FT+SLAKMKLPMD+ +SRV+YGSRAFF Sbjct: 376 YMKSMQQFTESLAKMKLPMDIESEPTTSGNSSTEQKLPQTKNANSRVYYGSRAFF 430 >gb|ACU18793.1| unknown [Glycine max] Length = 275 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/55 (52%), Positives = 34/55 (61%) Frame = -3 Query: 364 YMKSMQEFTDSLAKMKLPMDVXXXXXXXXXXXXXXXXXXXXTPSSRVFYGSRAFF 200 YMKSMQ+FT+SLAKMKLPMD+ + +SRVFYGSRAFF Sbjct: 221 YMKSMQQFTESLAKMKLPMDLESEPTSSGNSTTEQKLQPSKSNNSRVFYGSRAFF 275