BLASTX nr result
ID: Cnidium21_contig00037388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00037388 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520135.1| voltage-dependent anion-selective channel, p... 72 5e-11 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membra... 71 1e-10 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum] 71 1e-10 ref|XP_002312708.1| porin/voltage-dependent anion-selective chan... 71 1e-10 emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] 71 1e-10 >ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus communis] gi|223540627|gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus communis] Length = 276 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +3 Query: 3 ASALIQHAWHPKSLVTISGEVDTRAVEKSAKVGIALALKP 122 ASALIQH W PKSL TISGEVDTRA+EKSAK+G+ALALKP Sbjct: 237 ASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent anion-selective channel protein; Short=VDAC gi|515360|emb|CAA56600.1| 36kDA porin II [Solanum tuberosum] Length = 276 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 ASALIQHAWHPKSLVTISGEVDTRAVEKSAKVGIALALKP 122 ASALIQH W PKSL TISGEVDTRA+EKSAK+G+A+ALKP Sbjct: 237 ASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum] Length = 276 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 ASALIQHAWHPKSLVTISGEVDTRAVEKSAKVGIALALKP 122 ASALIQH W PKSL TISGEVDTRA+EKSAK+G+A+ALKP Sbjct: 237 ASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_002312708.1| porin/voltage-dependent anion-selective channel protein [Populus trichocarpa] gi|118484777|gb|ABK94257.1| unknown [Populus trichocarpa] gi|222852528|gb|EEE90075.1| porin/voltage-dependent anion-selective channel protein [Populus trichocarpa] Length = 276 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 ASALIQHAWHPKSLVTISGEVDTRAVEKSAKVGIALALKP 122 ASALIQH W PKSL TISGEVDT+A+EKSAK+G+ALALKP Sbjct: 237 ASALIQHEWRPKSLFTISGEVDTKAIEKSAKIGLALALKP 276 >emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] Length = 276 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 ASALIQHAWHPKSLVTISGEVDTRAVEKSAKVGIALALKP 122 ASALIQH W PKSL TISGEVDTRA+EKSAK+G+A+ALKP Sbjct: 237 ASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276