BLASTX nr result
ID: Cnidium21_contig00037297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00037297 (442 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625252.1| HAT family dimerization domain containing pr... 57 8e-07 >ref|XP_003625252.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355500267|gb|AES81470.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 317 Score = 56.6 bits (135), Expect(2) = 8e-07 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 1/96 (1%) Frame = +2 Query: 17 ASSSPLGSDSAHCLQSPHSSVSIHCVMS-SPTSPSIPDQSSEPSLTPESVPNESISSPAA 193 +S S S +AH QS + ++ V S + SP+ Q++ ES E++ P+ Sbjct: 99 SSLSLSDSSAAHVPQSFYLKMANEEVQSPNDVSPTQQTQTALDETNVESQEPEAVREPSV 158 Query: 194 TASDTKLRSDVWKHFDKKPIDGVMKAICKYCNEKLG 301 + + L+S W+H+ ++ DG KAICKYC++KLG Sbjct: 159 SPNKRGLKSVYWRHYKRQKFDGKFKAICKYCDKKLG 194 Score = 21.2 bits (43), Expect(2) = 8e-07 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +1 Query: 301 GDSNSGTTHLRKH 339 G++ +GT+HL+ H Sbjct: 195 GETTNGTSHLKDH 207