BLASTX nr result
ID: Cnidium21_contig00037082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00037082 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173490.1| hypothetical protein NitaMp153 [Nicotiana tabac... 160 1e-37 ref|YP_004222249.1| hypothetical protein BevumaM_p010 [Beta vulg... 139 2e-31 >ref|YP_173490.1| hypothetical protein NitaMp153 [Nicotiana tabacum] gi|56806655|dbj|BAD83556.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 109 Score = 160 bits (405), Expect = 1e-37 Identities = 77/85 (90%), Positives = 79/85 (92%) Frame = -1 Query: 343 PSSPLAV*AGCPSLLRSVRLWITGTNVIEWNSRRVTRSTVPRCEVQVVMITPGYALAPLT 164 PSSPLAV AGCPSLLRS +LWI GTNV+EWNSRRVTRSTVPRCEVQVVMITPGYALAPLT Sbjct: 25 PSSPLAVWAGCPSLLRSFKLWIKGTNVVEWNSRRVTRSTVPRCEVQVVMITPGYALAPLT 84 Query: 163 GTPEPANARENPGRPALHSSDRRCG 89 GTPEPANARENPGR LHSSDRR G Sbjct: 85 GTPEPANARENPGRSVLHSSDRRYG 109 >ref|YP_004222249.1| hypothetical protein BevumaM_p010 [Beta vulgaris subsp. maritima] gi|346683127|ref|YP_004842056.1| hypothetical protein BemaM_p008 [Beta macrocarpa] gi|317905687|emb|CBX33234.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439767|emb|CBX33286.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320147999|emb|CBJ20665.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500045|emb|CBX24861.1| hypothetical protein [Beta macrocarpa] gi|384939224|emb|CBL52070.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 145 Score = 139 bits (350), Expect = 2e-31 Identities = 66/73 (90%), Positives = 70/73 (95%) Frame = -1 Query: 343 PSSPLAV*AGCPSLLRSVRLWITGTNVIEWNSRRVTRSTVPRCEVQVVMITPGYALAPLT 164 PSSPLAV AGCPSLLRSVRLWI GTNV++W+S+RVTRSTVPRCEVQVVMITPGYALAPLT Sbjct: 40 PSSPLAVWAGCPSLLRSVRLWIRGTNVVKWDSKRVTRSTVPRCEVQVVMITPGYALAPLT 99 Query: 163 GTPEPANARENPG 125 GTP PANARENPG Sbjct: 100 GTPGPANARENPG 112