BLASTX nr result
ID: Cnidium21_contig00037050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00037050 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625415.1| WD repeat-containing protein [Medicago trunc... 64 1e-08 ref|XP_003554306.1| PREDICTED: WD repeat-containing protein 70-l... 59 4e-07 ref|XP_002320613.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 ref|XP_004152006.1| PREDICTED: WD repeat-containing protein 70-l... 56 4e-06 ref|XP_002526531.1| nucleotide binding protein, putative [Ricinu... 55 8e-06 >ref|XP_003625415.1| WD repeat-containing protein [Medicago truncatula] gi|355500430|gb|AES81633.1| WD repeat-containing protein [Medicago truncatula] Length = 611 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 176 EIYSGMRASFPISFGKQSKSQTPLETIHKSTLRSVDAS 63 EIY G+RA FP+SFGKQSKSQTPLETIHK+T RSV S Sbjct: 6 EIYDGVRAEFPLSFGKQSKSQTPLETIHKATRRSVPTS 43 >ref|XP_003554306.1| PREDICTED: WD repeat-containing protein 70-like [Glycine max] Length = 614 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = -2 Query: 185 QDEEIYSGMRASFPISFGKQSKSQTPLETIHKSTLRSVDASKDVNPFP 42 ++ +IY G+RA FP+SFGKQSK QTPLE IH +T RS K N P Sbjct: 3 EEGDIYDGVRAQFPLSFGKQSKPQTPLEAIHNATRRSNSNPKTANDLP 50 >ref|XP_002320613.1| predicted protein [Populus trichocarpa] gi|222861386|gb|EEE98928.1| predicted protein [Populus trichocarpa] Length = 647 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -2 Query: 185 QDEEIYSGMRASFPISFGKQSKSQTPLETIHKSTLRSVDASKDVN 51 ++ EIY G+RA FP++FGKQSKSQTPLE IH +T+R + N Sbjct: 4 EEAEIYDGVRAQFPLTFGKQSKSQTPLEQIHNTTIRKAPPTSAAN 48 >ref|XP_004152006.1| PREDICTED: WD repeat-containing protein 70-like [Cucumis sativus] gi|449509056|ref|XP_004163480.1| PREDICTED: WD repeat-containing protein 70-like [Cucumis sativus] Length = 646 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -2 Query: 182 DEEIYSGMRASFPISFGKQSKSQTPLETIHKSTLRSVDAS 63 + EIY G+RA FP++FGKQSK+QTPLE IH +T R+ S Sbjct: 4 EAEIYDGIRAQFPLTFGKQSKAQTPLEAIHNTTRRNTSVS 43 >ref|XP_002526531.1| nucleotide binding protein, putative [Ricinus communis] gi|223534092|gb|EEF35809.1| nucleotide binding protein, putative [Ricinus communis] Length = 658 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 182 DEEIYSGMRASFPISFGKQSKSQTPLETIHKSTLR 78 + +IY G+RA FP++FGKQSKSQTPLE IH ST R Sbjct: 16 EADIYDGIRAHFPLTFGKQSKSQTPLEVIHNSTRR 50