BLASTX nr result
ID: Cnidium21_contig00037002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00037002 (628 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273719.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 emb|CBI38862.3| unnamed protein product [Vitis vinifera] 68 2e-09 gb|AFK47264.1| unknown [Lotus japonicus] 62 7e-08 ref|XP_003552343.1| PREDICTED: pentatricopeptide repeat-containi... 62 9e-08 ref|XP_003623723.1| Pentatricopeptide repeat-containing protein ... 61 2e-07 >ref|XP_002273719.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Vitis vinifera] Length = 352 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/59 (62%), Positives = 44/59 (74%) Frame = -1 Query: 628 QKENKLNKALEFLIDLERNGILLEKEASTLLAGWFRSLGXXXXXXXXLRDYESCEAKCE 452 +KENKLNKAL+FLIDLER+GI+L KEAS LLA WF+ LG LR+Y + EA CE Sbjct: 290 EKENKLNKALDFLIDLERDGIVLGKEASELLAAWFQRLGVVKEVELVLREYSAKEASCE 348 >emb|CBI38862.3| unnamed protein product [Vitis vinifera] Length = 353 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = -1 Query: 628 QKENKLNKALEFLIDLERNGILLEKEASTLLAGWFRSLGXXXXXXXXLRDYESCEA 461 +KENKLNKAL+FLIDLER+GI+L KEAS LLA WF+ LG LR+Y + EA Sbjct: 290 EKENKLNKALDFLIDLERDGIVLGKEASELLAAWFQRLGVVKEVELVLREYSAKEA 345 >gb|AFK47264.1| unknown [Lotus japonicus] Length = 414 Score = 62.4 bits (150), Expect = 7e-08 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = -1 Query: 628 QKENKLNKALEFLIDLERNGILLEKEASTLLAGWFRSLGXXXXXXXXLRDYES 470 +KE+KLN ALEFLIDLE+ GI++ +EAS +LAGWFR LG LRD+ + Sbjct: 357 EKESKLNTALEFLIDLEKEGIMVGEEASAILAGWFRKLGVVEEVELVLRDFST 409 >ref|XP_003552343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Glycine max] Length = 414 Score = 62.0 bits (149), Expect = 9e-08 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -1 Query: 628 QKENKLNKALEFLIDLERNGILLEKEASTLLAGWFRSLGXXXXXXXXLRDY 476 +KE+K+N ALEFLIDLER+GI++E+EAS +LA WFR LG LRD+ Sbjct: 357 EKESKINTALEFLIDLERDGIMVEEEASAVLAKWFRKLGVVEEVELVLRDF 407 >ref|XP_003623723.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498738|gb|AES79941.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 426 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -1 Query: 628 QKENKLNKALEFLIDLERNGILLEKEASTLLAGWFRSLGXXXXXXXXLRDY 476 +KEN LN ALEFLI+LER+GI++++E S +LAGWFR LG LRD+ Sbjct: 367 EKENMLNTALEFLIELERDGIMVKEETSRILAGWFRKLGVVEEVELVLRDF 417