BLASTX nr result
ID: Cnidium21_contig00036946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036946 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF82159.1|AC068143_1 Contains similarity to an acyl-CoA oxid... 70 2e-10 gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thal... 70 2e-10 ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana... 70 2e-10 ref|XP_002889597.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata su... 70 2e-10 ref|XP_002525155.1| acyl-CoA oxidase, putative [Ricinus communis... 67 1e-09 >gb|AAF82159.1|AC068143_1 Contains similarity to an acyl-CoA oxidase from Myxococcus xanthus gb|AF013216 and contains an acyl-CoA oxidase PF|01756 domain. EST gb|AI997124 comes from this gene, partial [Arabidopsis thaliana] Length = 419 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 98 QCRQVIGGQGVMTENGVGQLKSEFDVETTFEGNNNVLMQRV 220 +CR+ +GGQGV TEN VGQLK EFDV+TTFEG+NNVLMQ+V Sbjct: 182 ECREAVGGQGVKTENLVGQLKGEFDVQTTFEGDNNVLMQQV 222 >gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thaliana] Length = 675 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 98 QCRQVIGGQGVMTENGVGQLKSEFDVETTFEGNNNVLMQRV 220 +CR+ +GGQGV TEN VGQLK EFDV+TTFEG+NNVLMQ+V Sbjct: 438 ECREAVGGQGVKTENLVGQLKGEFDVQTTFEGDNNVLMQQV 478 >ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana] gi|342161829|sp|P0CZ23.1|ACOX3_ARATH RecName: Full=Acyl-coenzyme A oxidase 3, peroxisomal; Short=AOX 3; Short=Acyl-CoA oxidase 3; AltName: Full=Medium-chain acyl-CoA oxidase; Short=AtCX3; Flags: Precursor gi|8515709|gb|AAF76137.1|AF253474_1 acyl-CoA oxidase [Arabidopsis thaliana] gi|20466227|gb|AAM20431.1| acyl-CoA oxidase ACX3 [Arabidopsis thaliana] gi|30725500|gb|AAP37772.1| At1g06290 [Arabidopsis thaliana] gi|51970656|dbj|BAD44020.1| hypothetical protein [Arabidopsis thaliana] gi|332189851|gb|AEE27972.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana] Length = 675 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 98 QCRQVIGGQGVMTENGVGQLKSEFDVETTFEGNNNVLMQRV 220 +CR+ +GGQGV TEN VGQLK EFDV+TTFEG+NNVLMQ+V Sbjct: 438 ECREAVGGQGVKTENLVGQLKGEFDVQTTFEGDNNVLMQQV 478 >ref|XP_002889597.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata] gi|297335439|gb|EFH65856.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata] Length = 675 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 98 QCRQVIGGQGVMTENGVGQLKSEFDVETTFEGNNNVLMQRV 220 +CR+ +GGQGV TEN VGQLK EFDV+TTFEG+NNVLMQ+V Sbjct: 438 ECREAVGGQGVKTENLVGQLKGEFDVQTTFEGDNNVLMQQV 478 >ref|XP_002525155.1| acyl-CoA oxidase, putative [Ricinus communis] gi|223535614|gb|EEF37282.1| acyl-CoA oxidase, putative [Ricinus communis] Length = 625 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 98 QCRQVIGGQGVMTENGVGQLKSEFDVETTFEGNNNVLMQRV 220 +CR+ GGQG+ TEN VG LKSEFDV+TTFEG+NNVLMQ+V Sbjct: 386 ECREACGGQGLKTENRVGNLKSEFDVQTTFEGDNNVLMQQV 426