BLASTX nr result
ID: Cnidium21_contig00036867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036867 (520 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554341.1| PREDICTED: calcium-transporting ATPase 4, en... 66 3e-09 ref|XP_003521357.1| PREDICTED: calcium-transporting ATPase 4, en... 66 3e-09 gb|AEP23079.1| hypothetical protein [Lolium perenne] 66 3e-09 dbj|BAJ99302.1| predicted protein [Hordeum vulgare subsp. vulgare] 66 3e-09 ref|NP_172259.1| Ca2+-transporting ATPase [Arabidopsis thaliana]... 65 8e-09 >ref|XP_003554341.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Glycine max] Length = 1060 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 419 LLCVGCWLINVKYFLSWEYFDRWPTNFKFSFKKC 520 L+C+ WLINVKYFLSWEY D WP NFKFSF+KC Sbjct: 291 LICILVWLINVKYFLSWEYVDGWPRNFKFSFEKC 324 >ref|XP_003521357.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Glycine max] Length = 1060 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 419 LLCVGCWLINVKYFLSWEYFDRWPTNFKFSFKKC 520 L+C+ WLINVKYFLSWEY D WP NFKFSF+KC Sbjct: 291 LICILVWLINVKYFLSWEYVDGWPRNFKFSFEKC 324 >gb|AEP23079.1| hypothetical protein [Lolium perenne] Length = 484 Score = 65.9 bits (159), Expect = 3e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 419 LLCVGCWLINVKYFLSWEYFDRWPTNFKFSFKKC 520 ++C+ WLINVKYFL+WEY D WPTNFKFSF+KC Sbjct: 292 VICILVWLINVKYFLTWEYVDGWPTNFKFSFEKC 325 >dbj|BAJ99302.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 560 Score = 65.9 bits (159), Expect = 3e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 419 LLCVGCWLINVKYFLSWEYFDRWPTNFKFSFKKC 520 ++C+ WLINVKYFL+WEY D WPTNFKFSF+KC Sbjct: 295 VICILVWLINVKYFLTWEYVDGWPTNFKFSFEKC 328 >ref|NP_172259.1| Ca2+-transporting ATPase [Arabidopsis thaliana] gi|12643704|sp|P92939.2|ECA1_ARATH RecName: Full=Calcium-transporting ATPase 1, endoplasmic reticulum-type gi|8439887|gb|AAF75073.1|AC007583_9 Strong similarity to ER-type calcium pump protein from Arabidopsis thaliana gb|U93845. ESTs gb|AA042787 and gb|AI992578 come from this gene [Arabidopsis thaliana] gi|1943751|gb|AAB52420.1| ER-type calcium pump [Arabidopsis thaliana] gi|2078292|gb|AAC68819.1| ER-type Ca2+-pumping ATPase [Arabidopsis thaliana] gi|7106179|gb|AAF36087.1| endoplasmic reticulum-type calcium-transporting ATPase 1 [Arabidopsis thaliana] gi|332190065|gb|AEE28186.1| Ca2+-transporting ATPase [Arabidopsis thaliana] Length = 1061 Score = 64.7 bits (156), Expect = 8e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 419 LLCVGCWLINVKYFLSWEYFDRWPTNFKFSFKKC 520 L+C WLINVKYFLSWEY D WP NFKFSF+KC Sbjct: 291 LICALVWLINVKYFLSWEYVDGWPRNFKFSFEKC 324