BLASTX nr result
ID: Cnidium21_contig00036619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036619 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540984.1| PREDICTED: uncharacterized protein LOC100808... 125 3e-27 ref|XP_003526221.1| PREDICTED: uncharacterized protein LOC100812... 124 1e-26 ref|XP_002320413.1| predicted protein [Populus trichocarpa] gi|2... 119 3e-25 ref|XP_003607595.1| hypothetical protein MTR_4g080050 [Medicago ... 118 6e-25 ref|XP_002528543.1| conserved hypothetical protein [Ricinus comm... 115 3e-24 >ref|XP_003540984.1| PREDICTED: uncharacterized protein LOC100808447 [Glycine max] Length = 416 Score = 125 bits (315), Expect = 3e-27 Identities = 59/104 (56%), Positives = 78/104 (75%) Frame = +2 Query: 65 MGDRRLDYYQPLLSVRRSPSPAPSEKNRSEKDDHSLPKIPTLPSYKSELKSGPIRNAGTV 244 M +++LD+ QPLLSVRR S A SE + K D +PK P LP YKSELKSGP+ N GTV Sbjct: 7 MEEKQLDFNQPLLSVRRISSTAASENDYKRKPDKPVPKRPPLPFYKSELKSGPVTNPGTV 66 Query: 245 PFVWEQCPGKPKDESKSRNCANQSPVIAPKLPPGRIMEMKKQTS 376 PFVWE+ PG+PK+ESK + A + P +APKLPPGR++++++Q S Sbjct: 67 PFVWEKTPGRPKNESKQQTQAVERPSVAPKLPPGRVLKVEQQDS 110 >ref|XP_003526221.1| PREDICTED: uncharacterized protein LOC100812760 [Glycine max] Length = 417 Score = 124 bits (310), Expect = 1e-26 Identities = 59/104 (56%), Positives = 78/104 (75%) Frame = +2 Query: 65 MGDRRLDYYQPLLSVRRSPSPAPSEKNRSEKDDHSLPKIPTLPSYKSELKSGPIRNAGTV 244 M +++LD+ QPLLSVRR S A SE + K D S+ K P LP YKSELKSGP+ N GTV Sbjct: 7 MEEKQLDFNQPLLSVRRISSTAASENDNKRKADKSVRKRPPLPFYKSELKSGPVTNPGTV 66 Query: 245 PFVWEQCPGKPKDESKSRNCANQSPVIAPKLPPGRIMEMKKQTS 376 PFVWE+ PG+PK+ESK + A + P +APKLPPGR++++++Q S Sbjct: 67 PFVWEKTPGRPKNESKLQTRAVERPSVAPKLPPGRVLKVEQQCS 110 >ref|XP_002320413.1| predicted protein [Populus trichocarpa] gi|222861186|gb|EEE98728.1| predicted protein [Populus trichocarpa] Length = 692 Score = 119 bits (298), Expect = 3e-25 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 1/105 (0%) Frame = +2 Query: 65 MGDRRLDYYQPLLSVRRSPSPAPSEKNR-SEKDDHSLPKIPTLPSYKSELKSGPIRNAGT 241 M ++LD+ QPLLSVRR S A +++ + K D +L +I P YKSELKSGP+RN GT Sbjct: 1 MEKKQLDFNQPLLSVRRFSSTASTKEAKIKRKTDDALSRISPPPVYKSELKSGPLRNPGT 60 Query: 242 VPFVWEQCPGKPKDESKSRNCANQSPVIAPKLPPGRIMEMKKQTS 376 VPFVWE+ PG+PKDESK +N A Q P IAPKLPPGRI++ ++Q S Sbjct: 61 VPFVWERSPGRPKDESKPQNRALQRPPIAPKLPPGRILKDQQQAS 105 >ref|XP_003607595.1| hypothetical protein MTR_4g080050 [Medicago truncatula] gi|355508650|gb|AES89792.1| hypothetical protein MTR_4g080050 [Medicago truncatula] Length = 696 Score = 118 bits (295), Expect = 6e-25 Identities = 54/102 (52%), Positives = 74/102 (72%) Frame = +2 Query: 65 MGDRRLDYYQPLLSVRRSPSPAPSEKNRSEKDDHSLPKIPTLPSYKSELKSGPIRNAGTV 244 M +++LD+ QPLLSVRR+ S SE N K + + K LP+YKSELKSGP+ N GTV Sbjct: 7 MEEKQLDFDQPLLSVRRASSTESSENNNKRKTEKPVSKRTRLPAYKSELKSGPVSNPGTV 66 Query: 245 PFVWEQCPGKPKDESKSRNCANQSPVIAPKLPPGRIMEMKKQ 370 PFVWE PG+PKDE K + + P++APKLPPGR++++K++ Sbjct: 67 PFVWENSPGRPKDEGKLQTRDIEEPLVAPKLPPGRVLKVKQR 108 >ref|XP_002528543.1| conserved hypothetical protein [Ricinus communis] gi|223532045|gb|EEF33855.1| conserved hypothetical protein [Ricinus communis] Length = 607 Score = 115 bits (289), Expect = 3e-24 Identities = 55/103 (53%), Positives = 75/103 (72%), Gaps = 1/103 (0%) Frame = +2 Query: 65 MGDRRLDYYQPLLSVRRSPSPAPS-EKNRSEKDDHSLPKIPTLPSYKSELKSGPIRNAGT 241 M +++LD+ QPLLSVRR S + E + +K +++ K+P LP YKSELKSGP+RN GT Sbjct: 7 MEEKQLDFNQPLLSVRRFSSTVSTIEADNKKKTENAFSKVPPLPKYKSELKSGPVRNPGT 66 Query: 242 VPFVWEQCPGKPKDESKSRNCANQSPVIAPKLPPGRIMEMKKQ 370 VPFVWE+ PGKPK E K + A Q P + PKLPPGR++ +++Q Sbjct: 67 VPFVWERSPGKPKCEIKPQTVALQQPPMIPKLPPGRMLNVERQ 109